Basic Information | |
---|---|
Taxon OID | 2077657009 Open in IMG/M |
Scaffold ID | BRPC3_GDEZLPW01B1YI4 Open in IMG/M |
Source Dataset Name | Bovine rumen viral communities from University of Illinois Dairy Farm in Urbana, IL, Cow rumen 6993 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 506 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Bovine Rumen Viral Communities From University Of Illinois Dairy Farm In Urbana, Il |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | University of Illinois Dairy Farm in Urbana, IL | |||||||
Coordinates | Lat. (o) | 40.0886 | Long. (o) | -88.2202 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F057815 | Metagenome / Metatranscriptome | 135 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BRPC3_00244560 | F057815 | N/A | MAKKIKDSDILKAMAMHLDEESVVFGANGHYANGAYYDITKVSSVFGDKDYNSQDAIDGADSTEAAKKYRTDNDKMDENLQKAIWLKNF |
⦗Top⦘ |