Scaffold AD_consensus_for_cluster_51430

Overview

Basic Information

• Taxon OID: 2070309008
• Scaffold ID: AD_consensus_for_cluster_51430
• Source Dataset Name: Wastewater viral communities from wastewater treatment facility in Singapore - AD-deduplicated data
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Illinois, Urbana-Champaign
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 500
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Unclassified → Wastewater → Wastewater Viral Communities From Wastewater Treatment Facility In Singapore

Source Dataset Sampling Location

• Location Name: Singapore: Singapore
• Coordinates
  • Lat. (^o): 1.332
  • Long. (^o): 103.756

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058560	Metagenome / Metatranscriptome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
AD_00579050	F058560	N/A	IECTXVQNVVKXANEVELIYPRTDEQEERRELAFICQSCLYVFGESDVENNNYSFRNESL