Scaffold AS_singleton_cluster_26020

Overview

Basic Information

• Taxon OID: 2070309006
• Scaffold ID: AS_singleton_cluster_26020
• Source Dataset Name: AS-dedpulicated data
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Illinois, Urbana-Champaign
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 502
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Wastewater → Wastewater Viral Communities From Wastewater Treatment Facility In Singapore

Source Dataset Sampling Location

• Location Name: Singapore: Singapore
• Coordinates
  • Lat. (^o): 1.332
  • Long. (^o): 103.756

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060712	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
AS_01496850	F060712	GGAGG	ITTLTDIANRALQVPGTRTTVTDAELAGNTTNEAIQINLVADSIRRQLIRMAPWDSALKTANLVYISSTPGTPENTSAATTLWQPGQPSPPWAYEYQYPVDCLRACWIIP