Scaffold IF_singleton_cluster_3953

Overview

Basic Information

• Taxon OID: 2070309005
• Scaffold ID: IF_singleton_cluster_3953
• Source Dataset Name: Wastewater viral communities from wastewater treatment facility in Singapore - IF-deduplicated data
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Illinois, Urbana-Champaign
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 541
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dojkabacteria → Candidatus Dojkabacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Unclassified → Wastewater → Wastewater Viral Communities From Wastewater Treatment Facility In Singapore

Source Dataset Sampling Location

• Location Name: Singapore: Singapore
• Coordinates
  • Lat. (^o): 1.332
  • Long. (^o): 103.756

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073597	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
IF_01483420	F073597	AGG	LPFSRRQALTKRGGMETGCFLLQGNQFVAGGRKFVLKRRKKPTPNKPELFLIQLQPFKYISSLFPAGEEGLYTFDYEGQLYILKKGEAQVVIAEEE