Scaffold LWAeNNiAF_GBUVFP102G015D

Overview

Basic Information

• Taxon OID: 2046860005
• Scaffold ID: LWAeNNiAF_GBUVFP102G015D
• Source Dataset Name: Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, sample from SIP 13C-methane aerobic no nitrate additional fraction
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 537
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles

Source Dataset Sampling Location

• Location Name: Lake Washington, Seattle
• Coordinates
  • Lat. (^o): 47.07
  • Long. (^o): -122.27889
  • Depth (m): 62

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014521	Metagenome / Metatranscriptome	262	Y

Sequences

Protein ID	Family	RBS	Sequence
LWAeNNiAF_2861430	F014521	N/A	LPDVSKALADPQHIYPVSKVVSVTIAKDSSPAGVLSEGDLLKLEPGQEAVLKNLAENSLLKMRVMTSKGEDGEVPAGTVVNVAVKDLQDFDNEFRAKLDLALTEAAKNKDAFKQGAVKK