Scaffold TEUFLG033109_F3MK0ZM02FPAXH

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold TEUFLG033109_F3MK0ZM02FPAXH

Scaffold TEUFLG033109_F3MK0ZM02FPAXH

Overview

Basic Information
Taxon OID	2046860002 Open in IMG/M
Scaffold ID	TEUFLG033109_F3MK0ZM02FPAXH Open in IMG/M
Source Dataset Name	Drinking water microbial communities from Ohio, US, that has been chlorinated or chloraminated - sample 11519, Newbler assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	454 Life Sciences
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	523
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water → Drinking Water Microbial Communities From Ohio, Us, That Has Been Chlorinated Or Chloraminated

Source Dataset Sampling Location
Location Name	Ohio, USA
Coordinates	Lat. (^o)	39.8	Long. (^o)	-84.3	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053842	Metagenome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
TEUFLG033109_3129010	F053842	N/A	MDKLTDLMAKRKWIKCCLRANVAQPEGVKLYGTIRVAKIYSNVLNVKDKEPELYDAIQTVAPEWWGDETQCTLNKDLVCKRHRDHANKEHSWILWLGDFTGDVSRVS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.