Scaffold MiccSOB_F3TY2AH02H3F68

Overview

Basic Information

• Taxon OID: 2046860001
• Scaffold ID: MiccSOB_F3TY2AH02H3F68
• Source Dataset Name: Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12382
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: 454 Life Sciences
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 514
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm Microbial Communities From Ohio, Us

Source Dataset Sampling Location

• Location Name: Ohio, USA
• Coordinates
  • Lat. (^o): 39.8
  • Long. (^o): -84.3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072535	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
MiccSOB_99650	F072535	N/A	FALSLLGLMRMESKNFDESIAMADYDNATRKASSLDIAKPSLSIRH