Scaffold ZMB_F548DK201ATG82

Overview

Basic Information

• Taxon OID: 2044078000
• Scaffold ID: ZMB_F548DK201ATG82
• Source Dataset Name: Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Illinois, Urbana-Champaign
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 565
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Switchgrass, Maize And Miscanthus Rhizosphere → Switchgrass, Maize And Miscanthus Rhizosphere Microbial Communities From University Of Illinois Energy Farm, Urbana, Il

Source Dataset Sampling Location

• Location Name: UIUC Energy Farm, Urbana, Illinois 61801
• Coordinates
  • Lat. (^o): 40.109
  • Long. (^o): -88.204

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003072	Metagenome / Metatranscriptome	509	Y

Sequences

Protein ID	Family	RBS	Sequence
ZMB_1962870	F003072	AGGAG	LKTKTPRQSVCNIPTDNPKEPYCGGKLKRITELDPDAKKAAGAGKDVFRCQKCKTLYVDESPYAVGKVKA