Scaffold ACOD_FV90NF402GQM6K

Overview

Basic Information

• Taxon OID: 2040502000
• Scaffold ID: ACOD_FV90NF402GQM6K
• Source Dataset Name: Fungus garden microbial communities from Atta colombica in Panama - dump bottom
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: 454 Life Sciences, DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 503
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden → Fungus Garden Microbial Communities From Leaf-Cutting Ants In Gamboa, Panama

Source Dataset Sampling Location

• Location Name: Gamboa, Panama
• Coordinates
  • Lat. (^o): 9.1167
  • Long. (^o): -79.7
  • Depth (m): .5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046624	Metagenome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
ACODB_21636240	F046624	N/A	FPEQLAEAGVWQVQRLFVRSRGGDAAGGFTIDPNEKDPVRGTTYAQQALAGLHKHASQGPWPKTVPPGGGRISRYGLVKQAPNSPAMPADAKTPLDGLQLPEQMSSRLAAPTIEGKPLTDFLERRLEVLVALMGARRRGVFTATPEVTALDPQRFKLMASRLDKALA