Scaffold FACEMD_F1OL2UU01CZ5X6

Overview

Basic Information

• Taxon OID: 2035918006
• Scaffold ID: FACEMD_F1OL2UU01CZ5X6
• Source Dataset Name: Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2+
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 503
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location

• Location Name: Maryland Wetland Ecosystem, MD
• Coordinates
  • Lat. (^o): 38.85
  • Long. (^o): -76.53
  • Depth (m): .01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001314	Metagenome / Metatranscriptome	725	Y

Sequences

Protein ID	Family	RBS	Sequence
FACEMDE_3175750	F001314	AGGAGG	MWILFEVPCPTPDGTTAESLYDRRVTGITPQMQASAAKHGCRFHRAWYARDGSAFIALASWDTREGASAFFEEWDIEDEPGETAT