Scaffold FACENC_F56XM5W01BMK9X

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold FACENC_F56XM5W01BMK9X

Scaffold FACENC_F56XM5W01BMK9X

Overview

Basic Information
Taxon OID	2035918004 Open in IMG/M
Scaffold ID	FACENC_F56XM5W01BMK9X Open in IMG/M
Source Dataset Name	Soil microbial communities from sample at FACE Site 2 North Carolina CO2-
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	529
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location
Location Name	Orange County, North Carolina
Coordinates	Lat. (^o)	36.0	Long. (^o)	-80.934	Alt. (m)		Depth (m)	.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075017	Metagenome / Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
FACENCA_7877810	F075017	N/A	LTETFGIALPKSSVDVVFGPDGVSRKIAVDTFINKELPPRYRSFTLDSNYVFGERKFRILSESLEPEMGGGDVDLSYWGLVHQPTFTGDFARLQERQRRAATEAPWTLDPLELVKKRYPDAKDVRLGVKQSGLAVVDFERVGCPAHVVVFQPLRETEGERSLWDFAVIRSPEEPAY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.