Scaffold WWPM1086_GHCZ7500_g1

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold WWPM1086_GHCZ7500_g1

Scaffold WWPM1086_GHCZ7500_g1

Overview

Basic Information
Taxon OID	2035918001 Open in IMG/M
Scaffold ID	WWPM1086_GHCZ7500_g1 Open in IMG/M
Source Dataset Name	Activated sludge microbial communities from Commune de Morges, Switzerland - plasmid pool Visp-2009 (Newbler)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	700
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Wastewater Plasmid Pools → Activated Sludge Microbial Communities From Commune De Morges, Switzerland

Source Dataset Sampling Location
Location Name	Visp, Switzerland
Coordinates	Lat. (^o)	46.30044	Long. (^o)	7.8594	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081940	Metagenome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
WWPMV_30620	F081940	N/A	LIEIRGQIAKKLKFWGQLGFKLIKFAAKDQYAKGAKL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.