Scaffold ErSWdraf_F5BXKTZ02HGZ0X

Overview

Basic Information

• Taxon OID: 2035265000
• Scaffold ID: ErSWdraf_F5BXKTZ02HGZ0X
• Source Dataset Name: Freshwater microbial communities from Swedish Lakes - surface of Lake Erken
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Royal Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 567
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Swedish Lakes

Source Dataset Sampling Location

• Location Name: Lake Erken, Sweden
• Coordinates
  • Lat. (^o): 59.84
  • Long. (^o): 18.63
  • Depth (m): 0 to 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045743	Metagenome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
ErSWdraft_2545560	F045743	N/A	MIANPTNVTIYIPKLFENLEVGDYVYGNQSLTVPPVNANFTISNGAKFIQLSGNQIINVGVC