Scaffold ErSWdraf_F5BXKTZ02F2BX7

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ErSWdraf_F5BXKTZ02F2BX7

Scaffold ErSWdraf_F5BXKTZ02F2BX7

Overview

Basic Information
Taxon OID	2035265000 Open in IMG/M
Scaffold ID	ErSWdraf_F5BXKTZ02F2BX7 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Swedish Lakes - surface of Lake Erken
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Royal Institute of Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	534
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Swedish Lakes

Source Dataset Sampling Location
Location Name	Lake Erken, Sweden
Coordinates	Lat. (^o)	59.84	Long. (^o)	18.63	Alt. (m)		Depth (m)	0 to 2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087185	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
ErSWdraft_11451400	F087185	N/A	MTHREYTLTVEKTIYEQLDANTKAVHLEEGETLTLGQKDFVSLLNGESFVRYVNAGQGMTATVTFSKENFANEATYTEVTISTGVAKLGKRKSK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.