Scaffold FACEOR_FY84VJD01BL3E1

Overview

Basic Information

• Taxon OID: 2032320005
• Scaffold ID: FACEOR_FY84VJD01BL3E1
• Source Dataset Name: Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2-
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 526
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location

• Location Name: Oak Ridge National Environmental Research Park, Tennessee, USA
• Coordinates
  • Lat. (^o): 35.9
  • Long. (^o): -84.4
  • Depth (m): .05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040738	Metagenome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
FACEORA_1181040	F040738	AGCAGG	MQRRIKAQQKEVAAYQTLIDHKQATLNVILSRIPDITTFAEIAELVGYSHEWVRQRLVQTPQKLYKNGKRYKVPKGV