Scaffold YNPsite05_CeleraDRAF_scf1119010635513

Overview

Basic Information

• Taxon OID: 2022920003
• Scaffold ID: YNPsite05_CeleraDRAF_scf1119010635513
• Source Dataset Name: Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP5 Bath Lake Vista Annex
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1459
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, WY
• Coordinates
  • Lat. (^o): 44.96507
  • Long. (^o): -110.71215

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093913	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
YNPsite05_CeleraDRAFT_189750	F093913	GGAGG	MRFYVKSVGTNIALVDIDTGDKVSVPTTALQKLFGVTPQQDEVWEFRAVRLDDIAESFRRWQVVQQALQQQGAQAQ