Scaffold YNPsite03_CeleraDRAF_deg1118686643321

Overview

Basic Information

• Taxon OID: 2022920002
• Scaffold ID: YNPsite03_CeleraDRAF_deg1118686643321
• Source Dataset Name: Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP3 Monarch Geyser, Norris Geyser Basin
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 554
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, WY
• Coordinates
  • Lat. (^o): 44.7242925
  • Long. (^o): -110.7056131

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004156	Metagenome / Metatranscriptome	450	Y

Sequences

Protein ID	Family	RBS	Sequence
YNPsite03_CeleraDRAFT_136390	F004156	AGGAGG	MSIRPSEEFELTPIMRKTISAMLEGVIVALTRLGYLEQDRANELIEKLNTDALNVGQLRLLTDVVIAWFSVSGYFSEAETEHLQELFNHLWGYYDMPLPKSRKKKRKTC