Scaffold VrWwAS_contig19489

Overview

Basic Information

• Taxon OID: 2020627001
• Scaffold ID: VrWwAS_contig19489
• Source Dataset Name: Viral communities in wastewater treatment process (AS)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Illinois, Urbana-Champaign
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 506
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes shahii (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Wastewater → Wastewater Viral Communities From Wastewater Treatment Facility In Singapore

Source Dataset Sampling Location

• Location Name: Singapore: Singapore
• Coordinates
  • Lat. (^o): 1.332
  • Long. (^o): 103.756

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098918	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
AS_761320	F098918	N/A	MNATIIFQTALMDKMYDNQDYDGMSMDDRMKMAESCGLALRKLIHTYTGLDTHKIEEFL