Scaffold VrWwTxAD_contig17986

Overview

Basic Information

• Taxon OID: 2020350001
• Scaffold ID: VrWwTxAD_contig17986
• Source Dataset Name: Viral communities in wastewater treatment process (AD)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Illinois, Urbana-Champaign
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 697
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Unclassified → Wastewater → Wastewater Viral Communities From Wastewater Treatment Facility In Singapore

Source Dataset Sampling Location

• Location Name: Singapore: Singapore
• Coordinates
  • Lat. (^o): 1.332
  • Long. (^o): 103.756

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058971	Metagenome / Metatranscriptome	134	N

Sequences

Protein ID	Family	RBS	Sequence
AD_917430	F058971	GGAGG	MTPNLIINLDIEPITLMWNGQAVSIPGTYELVPDSEVRHLHKRVMAIALHERRRIPFCGKLVGQAKSGKGSVWLVEDDRGQLIKSQKPMVVEGV