Scaffold PelMarPul_NODE_97_len_1329_cov_8_527464

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold PelMarPul_NODE_97_len_1329_cov_8_527464

Scaffold PelMarPul_NODE_97_len_1329_cov_8_527464

Overview

Basic Information
Taxon OID	2019105005 Open in IMG/M
Scaffold ID	PelMarPul_NODE_97_len_1329_cov_8_527464 Open in IMG/M
Source Dataset Name	Marine microbial communities from Pulau Tioman, Malaysia
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Illumina
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1355
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Community From Pulau Tioman, Malaysia

Source Dataset Sampling Location
Location Name	Pulau Tioman, Malaysia (South China Sea)
Coordinates	Lat. (^o)	2.8	Long. (^o)	104.2	Alt. (m)		Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073420	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
MgKW_36390	F073420	N/A	MKNVQIVLDQSRADKLDKISEATKGNMTNVSIAGEFIEFEQPKLSASKLAQALLNSAIDRAFSQLQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.