Scaffold YNP15_FYNB12572_g1

Overview

Basic Information

• Taxon OID: 2015219002
• Scaffold ID: YNP15_FYNB12572_g1
• Source Dataset Name: Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP15 Mushroom Spring
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 829
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, WY
• Coordinates
  • Lat. (^o): 44.538694
  • Long. (^o): -110.797972

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067777	Metagenome / Metatranscriptome	125	N

Sequences

Protein ID	Family	RBS	Sequence
YNP15590860	F067777	N/A	MPKLTIEVDPKAWQLLHQQAELRGLTPEALAQQLLLGELRARGKRSRRRDMDNESLHAASLPRGSLQRVFTTLERIDTLLPLDTPPPSREEVDSYVEQERASCGELRRGLSRCIESI