NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2014654228

Scaffold 2014654228


Overview

Basic Information
Taxon OID2014642001 Open in IMG/M
Scaffold ID2014654228 Open in IMG/M
Source Dataset NameMarine planktonic communities from Hawaii Ocean Times Series Station (HOT/ALOHA) - 4_Below_base_of_euphotic_200m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)813
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD12-C183(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha)

Source Dataset Sampling Location
Location NameHawaii Ocean Time Series, North Pacific Ocean
CoordinatesLat. (o)22.45Long. (o)-158.0Alt. (m)Depth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022779Metagenome213Y

Sequences

Protein IDFamilyRBSSequence
2014659798F022779N/AMAGKRKTTAKKKAVPVRKTKLSEDEKELRQQRLDALRNAPIQMPKSVYAARTQQADKLGTGEITGRPTDYVPKRIEDFLKNVRSGLPVMRAGAMVGIAKSTLYRWAEQYSDFKEAIDQAESEYQAFALGTVNDGIANGDGHLAMKLLGARFGDEYATSKKVDVRSTHVRSMISPDRLAGLQSARVETDVVSAANALGMEEPDALPEKVTQTPPENDDSAENEVGGTPTPGCKSP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.