Scaffold RicEn_FSXC82502_b1

Overview

Basic Information

• Taxon OID: 2010549000
• Scaffold ID: RicEn_FSXC82502_b1
• Source Dataset Name: Rice endophytes microbial communities from Berkeley, California, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 670
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Endophytes → Unclassified → Rice Endophytes → Rice Endophytes Microbial Communities From The International Rice Research Institute, Philippines

Source Dataset Sampling Location

• Location Name: Philippines: Los Banos
• Coordinates
  • Lat. (^o): 14.1677
  • Long. (^o): -121.2523

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021566	Metagenome / Metatranscriptome	218	Y

Sequences

Protein ID	Family	RBS	Sequence
RicEn_592700	F021566	GGAGG	MFTCKSYDKFTARVLAGLVLAVTIVFGSLTYAVSNVQAYI