Scaffold RicEn_FSXC3319_g1

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold RicEn_FSXC3319_g1

Scaffold RicEn_FSXC3319_g1

Overview

Basic Information
Taxon OID	2010549000 Open in IMG/M
Scaffold ID	RicEn_FSXC3319_g1 Open in IMG/M
Source Dataset Name	Rice endophytes microbial communities from Berkeley, California, USA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	798
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Endophytes → Unclassified → Rice Endophytes → Rice Endophytes Microbial Communities From The International Rice Research Institute, Philippines

Source Dataset Sampling Location
Location Name	Philippines: Los Banos
Coordinates	Lat. (^o)	14.1677	Long. (^o)	-121.2523	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080249	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
RicEn_196220	F080249	N/A	MIDATQRETPMTDNKQNKGTPDRNLISFKQKYEFDYAVKQLQKQIPDTTRQEAKDALAAAAKKISPSEGREKIMRAARKTLRD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.