Scaffold BISONQ_C15429

Overview

Basic Information

• Taxon OID: 2010170002
• Scaffold ID: BISONQ_C15429
• Source Dataset Name: 4_050719Q
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1142
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Bison Spring, Yellowstone National Park, Usa, Analyzing Thermal Gradients

Source Dataset Sampling Location

• Location Name: Bison Pool / Rosette Geyser, Yellowstone National Park
• Coordinates
  • Lat. (^o): 44.6
  • Long. (^o): -110.9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023604	Metagenome / Metatranscriptome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
BISONQ_371410	F023604	N/A	MDIRVPKAVVKSRALEKGVLKGMRPPAGEEEEKPWQAYAKKKNPCPVKIDYITS