Scaffold BISONR_C3579

Overview

Basic Information

• Taxon OID: 2010170001
• Scaffold ID: BISONR_C3579
• Source Dataset Name: 3_050719R
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 2743
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → unclassified Microcoleus → Microcoleus sp. FACHB-672 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Bison Spring, Yellowstone National Park, Usa, Analyzing Thermal Gradients

Source Dataset Sampling Location

• Location Name: Bison Pool / Rosette Geyser, Yellowstone National Park
• Coordinates
  • Lat. (^o): 44.6
  • Long. (^o): -110.9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028182	Metagenome / Metatranscriptome	192	N

Sequences

Protein ID	Family	RBS	Sequence
BISONR_100540	F028182	GAG	MPKVSISEAARRLETTEEVIREWIRLGLLDVELPSAKPRRTRELNPAFQPTSATPEPNVDLEQLYQ