Basic Information | |
---|---|
Taxon OID | 2009439000 Open in IMG/M |
Scaffold ID | bisonPool14jan08_BXAW4532_x1 Open in IMG/M |
Source Dataset Name | 2_050719S |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 677 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Bison Spring, Yellowstone National Park, Usa, Analyzing Thermal Gradients |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bison Pool / Rosette Geyser, Yellowstone National Park | |||||||
Coordinates | Lat. (o) | 44.5696298 | Long. (o) | -110.8651817 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003222 | Metagenome | 499 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BISONS_32498 | F003222 | AGGAG | MRHDMESCDQGGEDQDEAWLDGPVARVKGKSEALKRGTACDGEA |
⦗Top⦘ |