NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2008193365

Scaffold 2008193365


Overview

Basic Information
Taxon OID2008193000 Open in IMG/M
Scaffold ID2008193365 Open in IMG/M
Source Dataset NameMarine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Summer
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1097
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica

Source Dataset Sampling Location
Location NamePalmer Station B, Arthur Harbor, Antarctic Peninsula
CoordinatesLat. (o)-64.766667Long. (o)-64.05Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043621Metagenome / Metatranscriptome156Y

Sequences

Protein IDFamilyRBSSequence
2008193642F043621N/AMFKITLENTWNKNGIPTNYIKYLKVNTIEKVFEFYKLEDILEIEEC

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.