Scaffold 2007481900

Overview

Basic Information

• Taxon OID: 2007427000
• Scaffold ID: 2007481900
• Source Dataset Name: Uranium contaminated groundwater from Oak Ridge Integrated Field Research Center, Tennessee
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 809
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Oak Ridge Integrated Field Research Center, Tennessee, That Are Pristine And Uranium Contaminated

Source Dataset Sampling Location

• Location Name: DOE Field Research Center Area 3 Well FW106, Oakridge, TN
• Coordinates
  • Lat. (^o): 36.11569
  • Long. (^o): -84.248657
  • Depth (m): 21

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028479	Metagenome / Metatranscriptome	191	Y

Sequences

Protein ID	Family	RBS	Sequence
2007499645	F028479	AGGAGG	MPSLAKAYIATIGALAAAVLGLAAYRWNPEHLGQFVLFFMLAMVASTMKIRLPGLKTSISTNFVFILIGITLFSFSETV