NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2007460101

Scaffold 2007460101


Overview

Basic Information
Taxon OID2007427000 Open in IMG/M
Scaffold ID2007460101 Open in IMG/M
Source Dataset NameUranium contaminated groundwater from Oak Ridge Integrated Field Research Center, Tennessee
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)885
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Oak Ridge Integrated Field Research Center, Tennessee, That Are Pristine And Uranium Contaminated

Source Dataset Sampling Location
Location NameDOE Field Research Center Area 3 Well FW106, Oakridge, TN
CoordinatesLat. (o)36.11569Long. (o)-84.248657Alt. (m)Depth (m)21
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011249Metagenome / Metatranscriptome293Y

Sequences

Protein IDFamilyRBSSequence
2007471448F011249GGAGMIRSLSLLGTVAALAIAASASVPAMANGGDFFNELSESWGANADTGVPFFGWVRDARGKPIARAIVTATVQDGPDGQSVTIISDNLGHYKIPGLGKDIDAKKIVIDCAKVGYRAIQQDRRVLRTLPKAPVEVDCKLSPLAAATS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.