Basic Information | |
---|---|
Taxon OID | 2007309000 Open in IMG/M |
Scaffold ID | 2007310383 Open in IMG/M |
Source Dataset Name | Hot spring microbial communities from Yellowstone Bath Hot Springs, Wyoming, USA - Filamentous sample |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2159 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wyoming | |||||||
Coordinates | Lat. (o) | 44.560318 | Long. (o) | -110.8338344 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038745 | Metagenome / Metatranscriptome | 165 | Y |
F051572 | Metagenome / Metatranscriptome | 144 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2007312986 | F038745 | N/A | MDKAVVVVCGELMQISLAFSAYYPLCLGGPPCDFAEAVERLIRRAASARGAEELVEALGGRVRLEELGLPDPALEVLAEELGSEPRWLDALAASFFRLYLGLGRRRRVDGRDLALALCLWAQKKRREDPRNPLWRAAELKPDKLYTDEEAREALEMEERLFRRLWRRALAFHRGEKAYGFQLILAALSLMAAPPRSV |
2007312987 | F051572 | AGTAGG | VHGGPFAEVWTFADVVLEGGCKKSPQFLNTRLELCVLAALIKTAPAGSMVRLRPEIVRRLVEELAAAAGRDRERIRNALLKKAGEVLAQLRRELGDKTPAEALLAKLAELFLKELA |
⦗Top⦘ |