Scaffold 2001332450

Overview

Basic Information

• Taxon OID: 2001200001
• Scaffold ID: 2001332450
• Source Dataset Name: Soil microbial communities from Waseca County, Minnesota, USA - Sample 10150
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 1162
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Waseca County, Minnesota, Usa

Source Dataset Sampling Location

• Location Name: Waseca County, Minnesota, USA
• Coordinates
  • Lat. (^o): 44.152652
  • Long. (^o): -93.519745

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020725	Metagenome / Metatranscriptome	222	Y

Sequences

Protein ID	Family	RBS	Sequence
2001392558	F020725	GGAGG	VNPLRQLEQDVLAEGREWTRGRLEKCLQDQSDGLPALCPKTGEGLKDVRWRDLQLMSISGVIHLRVRHGYSPALGQWVCPARQAWGLQPYQRLSPELESRLAYTASQTTSYEAAAQMATRWGCAVSDG