Basic Information | |
---|---|
Taxon OID | 2001200001 Open in IMG/M |
Scaffold ID | 2001304356 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Waseca County, Minnesota, USA - Sample 10150 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 778 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Waseca County, Minnesota, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Waseca County, Minnesota, USA | |||||||
Coordinates | Lat. (o) | 44.152652 | Long. (o) | -93.519745 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F057484 | Metagenome | 136 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2001356704 | F057484 | AGGA | MSEHNDESLVTIASFETELEASFARGALQAIGISALVPGEWSGSFTGMYRGLPHRAELKVFALDRDRAIVELRRLQIRIVPPQNRT |
⦗Top⦘ |