 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F105771 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VGVVETAADFFKKRAGKATGEGLMKFLRTAPKLAPEPEDTLR |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (98.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.71% β-sheet: 0.00% Coil/Unstructured: 64.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF11645 | PDDEXK_5 | 3.00 |
| PF01381 | HTH_3 | 3.00 |
| PF04255 | DUF433 | 3.00 |
| PF13470 | PIN_3 | 2.00 |
| PF04365 | BrnT_toxin | 2.00 |
| PF03795 | YCII | 2.00 |
| PF13520 | AA_permease_2 | 2.00 |
| PF00999 | Na_H_Exchanger | 2.00 |
| PF13744 | HTH_37 | 1.00 |
| PF09411 | PagL | 1.00 |
| PF01850 | PIN | 1.00 |
| PF00296 | Bac_luciferase | 1.00 |
| PF13181 | TPR_8 | 1.00 |
| PF00330 | Aconitase | 1.00 |
| PF07687 | M20_dimer | 1.00 |
| PF10282 | Lactonase | 1.00 |
| PF08241 | Methyltransf_11 | 1.00 |
| PF02550 | AcetylCoA_hydro | 1.00 |
| PF07690 | MFS_1 | 1.00 |
| PF04545 | Sigma70_r4 | 1.00 |
| PF01797 | Y1_Tnp | 1.00 |
| PF12867 | DinB_2 | 1.00 |
| PF01464 | SLT | 1.00 |
| PF14279 | HNH_5 | 1.00 |
| PF01936 | NYN | 1.00 |
| PF13431 | TPR_17 | 1.00 |
| PF13155 | Toprim_2 | 1.00 |
| PF03459 | TOBE | 1.00 |
| PF05977 | MFS_3 | 1.00 |
| PF13485 | Peptidase_MA_2 | 1.00 |
| PF08281 | Sigma70_r4_2 | 1.00 |
| PF13426 | PAS_9 | 1.00 |
| PF05016 | ParE_toxin | 1.00 |
| PF13635 | DUF4143 | 1.00 |
| PF00795 | CN_hydrolase | 1.00 |
| PF13561 | adh_short_C2 | 1.00 |
| PF01063 | Aminotran_4 | 1.00 |
| PF02604 | PhdYeFM_antitox | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 3.00 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 2.00 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 2.00 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 2.00 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.00 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 2.00 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 2.00 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 2.00 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 2.00 |
| COG0427 | Propionyl CoA:succinate CoA transferase | Energy production and conversion [C] | 1.00 |
| COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 1.00 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.00 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.00 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.00 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.00 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 98.00 % |
| All Organisms | root | All Organisms | 2.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300026551|Ga0209648_10004520 | All Organisms → cellular organisms → Bacteria | 11828 | Open in IMG/M |
| 3300031823|Ga0307478_10000038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 163116 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.00% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.00% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.00% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005898 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_103717552 | 3300001593 | Forest Soil | ETAADFFKKRAGNASGEGLMRFLRTAAKAAPEADDTLR* |
| JGI25617J43924_100233982 | 3300002914 | Grasslands Soil | VGVIETAADFFKKRAGKAKGDGLLRFLRNAPRVAPEPEDQLR* |
| JGIcombinedJ51221_104190251 | 3300003505 | Forest Soil | VVETAADFFKKRAGKAAGEGLMKFLRTAPKLAPEPEDTLR* |
| Ga0062384_1000367792 | 3300004082 | Bog Forest Soil | VETAAAFFKRRAGKAKGDCLFKFLRQVPNTPPEPEDRIT* |
| Ga0062389_1040989252 | 3300004092 | Bog Forest Soil | GVVETAAEFFKKRTGKATGARLMKFLRSAPNVVPEPEDALR* |
| Ga0066388_1077270291 | 3300005332 | Tropical Forest Soil | VGVAETAADFFKRRAGKATGEGLIRFLRAASKSRPEAEDNL* |
| Ga0070709_100897112 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDTAAEFFKKRAGKAKGDDLMKFLRNAPNVQPELEDEMR* |
| Ga0070684_1003847831 | 3300005535 | Corn Rhizosphere | RLVETADQFFNQRGGKATGDGLMKFLRTAPGVVPEPEDRK* |
| Ga0070730_106209643 | 3300005537 | Surface Soil | AAFFQKRAGNAKGDGLLKFLRNAPDTPPEPEDRIT* |
| Ga0066661_103641961 | 3300005554 | Soil | VGVVETAADFFKKRAGKATGEGLMKFLRTAPKLAPEPEDTLR* |
| Ga0070761_103457933 | 3300005591 | Soil | AEKVGVVETAADFFRKRAGKATGEGLMKFLRTAPKLDPEPEDTHR* |
| Ga0070762_106148491 | 3300005602 | Soil | GVVETAADFFRKRAGKATGEGLMKFLRTAPKLAPEPDDTHR* |
| Ga0075276_100265112 | 3300005898 | Rice Paddy Soil | ETAAEFFRKRAGQTTGAGLMKFLRRAPHVKPEPEDETNGT* |
| Ga0075017_1011367321 | 3300006059 | Watersheds | VETAAEFFKKRAGNATGEGLMKFLRNAPDVLPEPEDVIK* |
| Ga0070716_1002038321 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DFFRKRAGKATGEGLMKFLRTAPKLAPEPEDTHR* |
| Ga0070765_1008587341 | 3300006176 | Soil | VVETAADFFRKRAGKATGEGLMKFLRTAPRLAPEPEDTHR* |
| Ga0070765_1013408012 | 3300006176 | Soil | MDCVGGGGKVGVVQTAAEFFKKRAGHKTGDQLMEFLRNAPNVLPEPEDKMR* |
| Ga0079221_108766042 | 3300006804 | Agricultural Soil | ETADQFFNQRGGKATGDGLMKFLRTAPGVVPEPEDRK* |
| Ga0099830_109080333 | 3300009088 | Vadose Zone Soil | AADFFKKRAGKATGEGLMKFLRTAPKGTPEPEDRLR* |
| Ga0099830_115430822 | 3300009088 | Vadose Zone Soil | ETAADFFKKRAGKAKGDGLMKFLRNAPRVAPEPEDQLR* |
| Ga0099828_101465261 | 3300009089 | Vadose Zone Soil | ADFFKKRAGKAKGDGLMKFLRNAPRVVPEPEDQLR* |
| Ga0116214_11040461 | 3300009520 | Peatlands Soil | AADFFKKRAGKATGAGLMKFLRTAPKLAPEPEDTIR* |
| Ga0074045_102424141 | 3300010341 | Bog Forest Soil | TAAEFFKKRAGQSTGDRLMKFLRHAPKVAPEPEDAIR* |
| Ga0134125_105794083 | 3300010371 | Terrestrial Soil | ETAADFFKKRAGKATGEGLMKFLHTAPRLAPEPENALR* |
| Ga0136449_1014353072 | 3300010379 | Peatlands Soil | ADFFKKRAGKATGAGLMKFLRTAPKLAPEPEDTIR* |
| Ga0134127_100697595 | 3300010399 | Terrestrial Soil | AVAEKVGVVETGADFFKKRAGKATGEGLMKFVHTAHRLAPEPENALR* |
| Ga0150983_121881701 | 3300011120 | Forest Soil | EKVGVVETAADFFRKRAGKATGEGLMKFLRTAPKLASEPEDTLR* |
| Ga0137392_104208403 | 3300011269 | Vadose Zone Soil | ADFFKKRAGKATGEGLMKFLRTAPKGTPEPEDRLR* |
| Ga0137388_103409281 | 3300012189 | Vadose Zone Soil | EKVGVVETAADFFKKRAGKATGEGLMKFLRTAPKGTPEPEDRLR* |
| Ga0137388_115055011 | 3300012189 | Vadose Zone Soil | EKVGVVETAADFFKKRAGKATGEGLMKFLRTAPKGTPEPEDGLR* |
| Ga0137364_101388005 | 3300012198 | Vadose Zone Soil | VGVVETAADFFKKRAGKATGEGLMKFLRTAPKLAPEPEDTHR* |
| Ga0137383_100310086 | 3300012199 | Vadose Zone Soil | AADFFKKRAGKAKGDGLMKFLRNAPRVAPEPEDQLR* |
| Ga0137382_100970771 | 3300012200 | Vadose Zone Soil | KVGVVETAADFFKKRAGKATGEGLMKFLRTAPKLAPEPEDTLR* |
| Ga0137384_108649811 | 3300012357 | Vadose Zone Soil | KVGVIETASDFFKKRAGKATGAGLMKYLRTAPKSAPAPEDRLR* |
| Ga0137360_113629112 | 3300012361 | Vadose Zone Soil | VVETAADFFKKRAGKATGEGLMKYLRTAPKIAPEPEDTLR* |
| Ga0137390_106247161 | 3300012363 | Vadose Zone Soil | AADFFKKRAGKASGEGLMKFLRTAPKGAPEPEDRLR* |
| Ga0137358_100923441 | 3300012582 | Vadose Zone Soil | EKVGVVETAADFFKKRAGKATGEGLMKFLRTAPKLAPEPEDTLR* |
| Ga0137358_102982432 | 3300012582 | Vadose Zone Soil | EKVGVVETAADFFKKRAGKATGEGLMKFLRTAPKLAPEPEDSLR* |
| Ga0137397_104985222 | 3300012685 | Vadose Zone Soil | VDRCRCREKVGVIETAAGFFKKCAGKVKGDGLMKFLRNAPRVIPEPEDQLR* |
| Ga0137396_106471652 | 3300012918 | Vadose Zone Soil | AADFFRKRAGKATGEGLMKFLRTAPKLAPEPEDTHR* |
| Ga0137404_101902061 | 3300012929 | Vadose Zone Soil | VFRSKVRSRRVIETAADFFKKRAGKTKGDALMKFLRNAPRVAPEPEDQLR* |
| Ga0126369_102296351 | 3300012971 | Tropical Forest Soil | AADFFKKRAGKARGDGLMKLLRNAPRVVPEPEDQLR* |
| Ga0181538_106564992 | 3300014162 | Bog | VETAADFFKKRAGEATGEGLMKFLRTALKTAPDPEDTLR* |
| Ga0182010_105101552 | 3300014490 | Fen | VVETAADFFKKRAGEATGEGLMKFSRTAPKTAPEPDDTLR* |
| Ga0137409_110816421 | 3300015245 | Vadose Zone Soil | ADFFKKRAGKATGDGLMKFLRNAPRVAPEPEDQLR* |
| Ga0182035_113723902 | 3300016341 | Soil | AETADDFFKRRAGTATGGGLMKFLRRAPKSRPEAEDSL |
| Ga0182039_104615641 | 3300016422 | Soil | DRCGRGRKGWVVETAAESFKKRAGSATGAGLMKFLKNAPKVPPQRGDEVR |
| Ga0187808_100315475 | 3300017942 | Freshwater Sediment | VGVVETAAEFFKKRAGKATGAGLMKFLRRAPNVTPEPEDAGR |
| Ga0187819_107542922 | 3300017943 | Freshwater Sediment | VETAAEFFKKRAGKATGAGLMKFLRRAPNVTPEPEDAGR |
| Ga0187817_102109161 | 3300017955 | Freshwater Sediment | ETAADFFKKRAGKAKGEGLMKFLRNAPRVAPEPEDQLR |
| Ga0187817_103544431 | 3300017955 | Freshwater Sediment | VGVVETAADFFKNRAGKATGAGLMKFLRTVPKAAPEPEDEIR |
| Ga0187779_111247681 | 3300017959 | Tropical Peatland | AAEFFKKRAGNATGKGLMRFLRHAPDVTPEPEDSLG |
| Ga0187777_110746142 | 3300017974 | Tropical Peatland | TAAEFFRKRAGKARGSGMMKFLRRAPRTIPDENDEIA |
| Ga0187872_101629492 | 3300018017 | Peatland | GGSRGRLFKKRAGNATGEGLMKFLRTAPKIAPEPEDTLR |
| Ga0187871_106124051 | 3300018042 | Peatland | TAADFFKKRSGNATGAGLMKFLRTAPKLAPEPEDTIR |
| Ga0187784_114825792 | 3300018062 | Tropical Peatland | VETAAEFFKKRAGKATGAGMMKFLRNAPITVPETMDLA |
| Ga0187784_116073031 | 3300018062 | Tropical Peatland | TAAEFFKKRAGKATGAGMMKFLRNAPKAAPAPEDALR |
| Ga0066669_113939022 | 3300018482 | Grasslands Soil | VGVVETAAEFFKKRAGKATGTGLMRFLRQAPKNVPPPDDVVR |
| Ga0179592_102313282 | 3300020199 | Vadose Zone Soil | VGVVETAADFFKKRAGKAAGEGLMKFLRTAPKLAAEPEDTLR |
| Ga0179592_102577243 | 3300020199 | Vadose Zone Soil | ETAADFFRKRAGKATGEGLMKFLRTAPKLPPEPEDTHR |
| Ga0210407_100441255 | 3300020579 | Soil | VVETAADFFKKRAGKATGAGLMKFLRTAPKSAPAPEDGMR |
| Ga0210407_101775773 | 3300020579 | Soil | GVVETAADFFRKRAGKATGEGLMKFLRTAPKLAPESEDTHR |
| Ga0210403_105853711 | 3300020580 | Soil | ADFFKKRAGKATGTGLMKFLRTAPKAAPEPEDEMR |
| Ga0210406_106673872 | 3300021168 | Soil | VGVVETAADFFKKRAGKATGAGLMRFLRTAPKAAPEAEDTL |
| Ga0210405_100137575 | 3300021171 | Soil | VGVVETPADFFKKWARKATGGSLMKFLRATPKAGPEPEDETR |
| Ga0210408_101076972 | 3300021178 | Soil | VGVVETAADFFKKWARKATGGSLMKFLRGAPKAGPEPEDETR |
| Ga0210396_101159984 | 3300021180 | Soil | ADFFRKRAGKATGEGLMKFLRTAPKLAAEPEDTLR |
| Ga0210393_100050081 | 3300021401 | Soil | GVVETAADFFRKRAGKATGEGLMKFLRTAPKLAAEPEDTLG |
| Ga0210394_105439191 | 3300021420 | Soil | KVGVVETAADFFRKRAGKATGEGLMKFLRTAPKLAPEPEDTHR |
| Ga0210402_100076211 | 3300021478 | Soil | VETAADFFRKRAGKATGEGLMKFLRTAPKLAPEPEDTHR |
| Ga0210402_106025673 | 3300021478 | Soil | VETAADFFKKRAGKAAGEGLMKFLRTAPKLAPEPEDTLR |
| Ga0210402_115142762 | 3300021478 | Soil | TAADFFRKRAGKATGEGLMKFLRTAPKLAAEPEDTLR |
| Ga0210409_101138174 | 3300021559 | Soil | MKNKKIGVVETAAEFFKKRASQKTGDRLIEFLRNAPNVLPEPEDKVR |
| Ga0242657_11281641 | 3300022722 | Soil | ETAADFFKKRAGKATGAGLMKFLRTAPKTAPEPEDTI |
| Ga0207646_117912201 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDTAAEFFKKRAGKAKGDDLMKFLRNAPNVQPELEDEM |
| Ga0209375_10182261 | 3300026329 | Soil | VAFPAEFFKKRAGKATGTGLMRFLQQAPKNVPPPDDVVR |
| Ga0209648_1000452016 | 3300026551 | Grasslands Soil | VGVIETAADFFKKRAGKAKGDGLLRFLRNAPRVAPEPEDQLR |
| Ga0179587_103602431 | 3300026557 | Vadose Zone Soil | VVETAADFFKKRAGKATGAGLMKFLRNAPKAAPETDDRL |
| Ga0209626_10390212 | 3300027684 | Forest Soil | QKVGVIETAADFFKKRAGKATGAGLIKFLRTAPKAAPELQDEIR |
| Ga0209448_101494641 | 3300027783 | Bog Forest Soil | VETAAAFFKRRAGKAKGDCLFKFLRQVPNTPPEPEDRIT |
| Ga0209693_103542151 | 3300027855 | Soil | METAAEFFKKRAGVKTGDRLMEFLHNAPHVPPEPEDMR |
| Ga0209701_105540731 | 3300027862 | Vadose Zone Soil | GVIETAADFFKKRAGKAKGDGLMKFLRNAPRVAPEPEDQLR |
| Ga0209067_104990052 | 3300027898 | Watersheds | AEFFKKHAGNATGEGLMKFLRTAPKIAPEPEDTLR |
| Ga0308309_100788333 | 3300028906 | Soil | MDCVGGGGKVGVVQTAAEFFKKRAGHKTGDQLMEFLRNAPNVLPEPEDKMR |
| Ga0222749_104072363 | 3300029636 | Soil | VETAADFFKKWTGKATGEGLVRLLRTAPKATPDAEDTL |
| Ga0311368_100620901 | 3300029882 | Palsa | AAEFFKKRAGKRTGDGLMEFLRSAPNVAPEPDDMR |
| Ga0265760_103367001 | 3300031090 | Soil | VVETAADFFKKRVGKATGAGLMKFLRSAPKAAPEPEDEMR |
| Ga0310686_1030497881 | 3300031708 | Soil | VVVETAADFFKKRTGKATGAGLTKFLRTAPKSAPDPEDEMR |
| Ga0310686_1148313122 | 3300031708 | Soil | EKVGVVETAADFFEKRAGKAAGEGLMKFLRTAPKLAAEPEDTHR |
| Ga0307478_10000038125 | 3300031823 | Hardwood Forest Soil | METAAEFFKKRAGQKTGDRLMEFLRNAPNVLPEPEDKVR |
| Ga0306923_111782522 | 3300031910 | Soil | VVETAAEFFKKRAGKATGAGLMKFLRNALEAQPEPEDVVR |
| Ga0310913_101604831 | 3300031945 | Soil | EKVGVVETAAEFFKKRAGKATGAGLMKFLRQPLDVPPEPNDQPR |
| Ga0310909_103104643 | 3300031947 | Soil | VGVVETAAQFFKQRAGNATGAGLMKFLRTAPRVTPEPEDRK |
| Ga0307479_104273831 | 3300031962 | Hardwood Forest Soil | GVVETAADFFKKRAGKAAGEGLMKFLRTAPKLAPEPDDTLR |
| Ga0318533_113350811 | 3300032059 | Soil | VVETAAEFFKKRAGKATGAGLMKFLRNALEAQPEPED |
| Ga0335085_105039021 | 3300032770 | Soil | VGVIETAADFFKKRAGKATEAGLMKFLRTAPKAAPAAEDTIRREPALL |
| Ga0335079_100501843 | 3300032783 | Soil | VVETAAEFFKKRAGDASGADLMKFLRNAPKAAPEPEDKLK |
| Ga0335083_100792272 | 3300032954 | Soil | VGVIETAADFFKKRAGKATEAGLMKFLRTAPKAAPDAEDTIRRERALL |
| Ga0310810_108996391 | 3300033412 | Soil | VGVVETADQFFKQRGGKATGDGLMKFLRTAPGVVPEPEDRK |
| Ga0326726_104759373 | 3300033433 | Peat Soil | VGVVETAAEFFKKRAGKATGEGLMKSLRTAPKVAPEPEDTLR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |