NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105630

Metagenome / Metatranscriptome Family F105630

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105630
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 51 residues
Representative Sequence YLVTDGAQGYFGEKLGFAAVDRKDVAPEIAATAEYALARSKSATWMRKEL
Number of Associated Samples 95
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.00 %
% of genes from short scaffolds (< 2000 bps) 95.00 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.64

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (61.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.000 % of family members)
Environment Ontology (ENVO) Unclassified
(30.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(46.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.64%    β-sheet: 17.95%    Coil/Unstructured: 56.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.64
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF00459Inositol_P 86.00
PF12804NTP_transf_3 8.00
PF01479S4 2.00
PF02687FtsX 1.00
PF02562PhoH 1.00
PF00072Response_reg 1.00
PF04893Yip1 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG1702Phosphate starvation-inducible protein PhoH, predicted ATPaseSignal transduction mechanisms [T] 1.00
COG1875Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domainsGeneral function prediction only [R] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms61.00 %
UnclassifiedrootN/A39.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_180828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis727Open in IMG/M
3300003321|soilH1_10262943All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1252Open in IMG/M
3300003323|rootH1_10086346All Organisms → cellular organisms → Bacteria1527Open in IMG/M
3300004047|Ga0055499_10001425All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1881Open in IMG/M
3300004047|Ga0055499_10017456All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium922Open in IMG/M
3300004114|Ga0062593_100510548All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1117Open in IMG/M
3300004157|Ga0062590_100145894All Organisms → cellular organisms → Bacteria → Proteobacteria1610Open in IMG/M
3300004643|Ga0062591_102945384Not Available505Open in IMG/M
3300005093|Ga0062594_102615129Not Available557Open in IMG/M
3300005337|Ga0070682_101063287All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300005340|Ga0070689_102017610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium528Open in IMG/M
3300005356|Ga0070674_100853197Not Available790Open in IMG/M
3300005365|Ga0070688_101630620All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300005367|Ga0070667_100463479All Organisms → cellular organisms → Bacteria1159Open in IMG/M
3300005367|Ga0070667_102280076Not Available510Open in IMG/M
3300005437|Ga0070710_10258034All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300005529|Ga0070741_10099785All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3087Open in IMG/M
3300005530|Ga0070679_100033233All Organisms → cellular organisms → Bacteria5107Open in IMG/M
3300005530|Ga0070679_101511381Not Available618Open in IMG/M
3300005535|Ga0070684_101753571Not Available586Open in IMG/M
3300005541|Ga0070733_10280015All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1100Open in IMG/M
3300005544|Ga0070686_100363522All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1091Open in IMG/M
3300005548|Ga0070665_100576278All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1138Open in IMG/M
3300005577|Ga0068857_100965463All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium819Open in IMG/M
3300005616|Ga0068852_102309493All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300005718|Ga0068866_10301306All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1001Open in IMG/M
3300005993|Ga0080027_10119985All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium996Open in IMG/M
3300006175|Ga0070712_100850258Not Available785Open in IMG/M
3300006175|Ga0070712_101719521All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300006358|Ga0068871_101917600Not Available563Open in IMG/M
3300006844|Ga0075428_100856642All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium965Open in IMG/M
3300009156|Ga0111538_12356011Not Available668Open in IMG/M
3300009177|Ga0105248_13369250All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium508Open in IMG/M
3300009551|Ga0105238_11451767All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium714Open in IMG/M
3300010397|Ga0134124_11757402Not Available653Open in IMG/M
3300010398|Ga0126383_12630234Not Available587Open in IMG/M
3300010399|Ga0134127_12471885Not Available599Open in IMG/M
3300010400|Ga0134122_11553663All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium683Open in IMG/M
3300010401|Ga0134121_12657185Not Available545Open in IMG/M
3300012039|Ga0137421_1152201Not Available681Open in IMG/M
3300012358|Ga0137368_10157653All Organisms → cellular organisms → Bacteria1668Open in IMG/M
3300012530|Ga0136635_10013491Not Available2433Open in IMG/M
3300012582|Ga0137358_10932985Not Available567Open in IMG/M
3300012682|Ga0136611_10253640Not Available1178Open in IMG/M
3300012684|Ga0136614_10540145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria836Open in IMG/M
3300012929|Ga0137404_10478658All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1108Open in IMG/M
3300012944|Ga0137410_10866507Not Available762Open in IMG/M
3300012944|Ga0137410_11082709All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium685Open in IMG/M
3300012971|Ga0126369_10872647All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium984Open in IMG/M
3300012985|Ga0164308_10860893All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium795Open in IMG/M
3300013105|Ga0157369_12265290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium551Open in IMG/M
3300013307|Ga0157372_13015590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes538Open in IMG/M
3300014325|Ga0163163_12254185Not Available604Open in IMG/M
3300015245|Ga0137409_11392066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium546Open in IMG/M
3300015374|Ga0132255_101538993All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1007Open in IMG/M
3300016357|Ga0182032_11568366Not Available572Open in IMG/M
3300016371|Ga0182034_12017616Not Available510Open in IMG/M
3300018073|Ga0184624_10147275All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1033Open in IMG/M
3300018432|Ga0190275_10770220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1024Open in IMG/M
3300018469|Ga0190270_11113807All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium823Open in IMG/M
3300020057|Ga0163151_10555743Not Available540Open in IMG/M
3300021384|Ga0213876_10740520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium523Open in IMG/M
3300021403|Ga0210397_10656404All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium804Open in IMG/M
3300021404|Ga0210389_11512477All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300025315|Ga0207697_10480404All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300025703|Ga0208357_1080141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium999Open in IMG/M
3300025912|Ga0207707_10886273All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium738Open in IMG/M
3300025935|Ga0207709_11581157Not Available544Open in IMG/M
3300025942|Ga0207689_10890022All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium751Open in IMG/M
3300025972|Ga0207668_11407153Not Available629Open in IMG/M
3300025981|Ga0207640_11952661Not Available531Open in IMG/M
3300026067|Ga0207678_11174288Not Available680Open in IMG/M
3300026095|Ga0207676_11014000Not Available818Open in IMG/M
3300026557|Ga0179587_10965992All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium561Open in IMG/M
3300027867|Ga0209167_10394593Not Available754Open in IMG/M
3300027880|Ga0209481_10716964Not Available520Open in IMG/M
3300028573|Ga0265334_10156263All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium803Open in IMG/M
3300028666|Ga0265336_10200215Not Available593Open in IMG/M
3300029636|Ga0222749_10548051Not Available629Open in IMG/M
3300029984|Ga0311332_10084241All Organisms → cellular organisms → Bacteria2283Open in IMG/M
3300030294|Ga0311349_11824425All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria561Open in IMG/M
3300031228|Ga0299914_11516269Not Available522Open in IMG/M
3300031232|Ga0302323_102971879All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300031249|Ga0265339_10053633All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2193Open in IMG/M
3300031469|Ga0170819_17318057Not Available680Open in IMG/M
3300031640|Ga0318555_10328545Not Available828Open in IMG/M
3300031726|Ga0302321_103022497All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300031765|Ga0318554_10367806Not Available817Open in IMG/M
3300031771|Ga0318546_10359886All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1013Open in IMG/M
3300031777|Ga0318543_10047932All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1734Open in IMG/M
3300031894|Ga0318522_10264396Not Available652Open in IMG/M
3300031962|Ga0307479_12100940Not Available513Open in IMG/M
3300032001|Ga0306922_10881152All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium931Open in IMG/M
3300032002|Ga0307416_103569107Not Available521Open in IMG/M
3300032035|Ga0310911_10513211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae695Open in IMG/M
3300032043|Ga0318556_10720498All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales519Open in IMG/M
3300032068|Ga0318553_10215354All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1002Open in IMG/M
3300032261|Ga0306920_101329971All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1033Open in IMG/M
3300032829|Ga0335070_11235964Not Available685Open in IMG/M
3300032955|Ga0335076_10421714All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1218Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere5.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.00%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen4.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.00%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere3.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.00%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat1.00%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.00%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.00%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.00%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots1.00%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil1.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003323Sugarcane root Sample H1Host-AssociatedOpen in IMG/M
3300004047Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012682Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06)EnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300020057Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025703Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028573Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaGHost-AssociatedOpen in IMG/M
3300028666Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaGHost-AssociatedOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_030908302199352025SoilYFGEKLGFQAIDRKDIVPAIQATAEYALARSKNATWMRKEL
soilH1_1026294313300003321Sugarcane Root And Bulk SoilLVTDGAQGYFGQKLGFTIVDRKGVDPKITTTAEYLLARSKDAVWMHKDL*
rootH1_1008634623300003323Sugarcane Root And Bulk SoilARALGVRTLFLATDGAQGYFGEKLGFQIVERKDIAPEIMGTAEFALARSKTAAWMRKSLEPAA*
Ga0055499_1000142513300004047Natural And Restored WetlandsVTDGAQGYFGEKLGFAAIDRKDVVAPIQATAEYALARSKNATWMRKEL*
Ga0055499_1001745623300004047Natural And Restored WetlandsAQGVRHLYLVTDGAQGYFGEKLGFVAIDRKDVAPEIAATAEYALARSKAATWMRKEL*
Ga0062593_10051054813300004114SoilYFGEKLGFQAIDRKEVVPAIRATAEYALARSKNATWMRKEL*
Ga0062590_10014589443300004157SoilAEGVQRLYLVTDGAQGFFGDNFGFEPIDRKDVDPAIQTTVEYQMPRNKDATWMRKVL*
Ga0062591_10294538413300004643SoilGVQRLYLVTDGAQGFFGENFGFEAIERKDVDAAIQTTVEYQMARNKDATWMRKVL*
Ga0062594_10261512913300005093SoilGVRHLYLVTDGAQGYFGEKLGFTAIDRKDVVASIQATAEYNLARSKNATWMRKEL*
Ga0070682_10106328713300005337Corn RhizosphereRLYLVTDGAQGFFGDNFGFEAIDRKDVDPAIQTTVEYQMTRNKEATWMRKVL*
Ga0070689_10201761013300005340Switchgrass RhizosphereSQGVRHLYLVTDGAQGYFGEKLGFTAIDRKDVVASIQATAEYNLARSKNATWMRKEL*
Ga0070674_10085319713300005356Miscanthus RhizosphereSQGVRHLYLVTDGAQGYFGEKLGFTAIDRKDVGPAVAATAEYMLARSKNATWMTKEL*
Ga0070688_10163062023300005365Switchgrass RhizosphereEGLGYVLVEAATERARSQGVRHLYLVTDGAQGYFGEKLGFTAIDRKDVAAAVAATAEYMLARSKNATWMTKEL*
Ga0070667_10046347933300005367Switchgrass RhizosphereSQGVRHLYLVTDGAQGYFGEKLGFQAIDRKDVVAPIQATAEYALARSKNATWMRKEL*
Ga0070667_10228007613300005367Switchgrass RhizosphereLYLVTDGAQGYFGEKLGFTAIDRKDVAAAVAATAEYMLARSKNATWMTKEL*
Ga0070710_1025803423300005437Corn, Switchgrass And Miscanthus RhizosphereYLVTDGAQGYFGEKLGFQVVDRKDVAPEIAATAEYALARSKNATWMRKDL*
Ga0070741_1009978513300005529Surface SoilFGEKLGFVPVDRKDVDAPVTTTAEYLLARSKTATWMRKDL*
Ga0070679_10003323373300005530Corn RhizosphereQLYLVTDGAQGYFGEKLGFQAVDRKDVVAEVAATAEYALARSKNATWMRKDL*
Ga0070679_10151138123300005530Corn RhizosphereARGVKHLYLVTDGAQNYFGEKLGFAVVDRKNIDGKIAATAEYMLARSKDAMWMRKEL*
Ga0070684_10175357113300005535Corn RhizosphereVETATERARSQGVQHLYLVTDGAQGYFGERLGFSVIDRKDVAPEVAGTAEYLLARSKNATWMRKEL*
Ga0070733_1028001533300005541Surface SoilGAQGYFGEKLGFVAIDRKDVDPSIAQTAEYLLARSKAATWMRKDL*
Ga0070686_10036352223300005544Switchgrass RhizosphereSQGVRHLYLVTDGAQGYFGEKLGFTAIDRKDVDPAITTTAEYQLARSRTATWMRKDL*
Ga0070665_10057627813300005548Switchgrass RhizosphereQGYFGQKLGFIVVDRKDVDPKIATTAEYLLARSKNAAWMRKEL*
Ga0068857_10096546323300005577Corn RhizosphereDGAQGYFGERLGFTVIDRKDVDPKVTTTAEYMLARSKGATWMRKDL*
Ga0068852_10230949313300005616Corn RhizosphereYLVTDGAQGYFGEKLGFQAVDRKDVVAEVAATAEYALARSKNATWMRKDL*
Ga0068866_1030130623300005718Miscanthus RhizosphereYFGEKLGFAAIDRKDVVAPIQATAEYALARSKNATWMRKEL*
Ga0080027_1011998523300005993Prmafrost SoilFQAVDRKDVAPEIAATAEYALARSKNATWMRKDL*
Ga0070712_10085025813300006175Corn, Switchgrass And Miscanthus RhizosphereDGAQGYFGEKLGFVATDRKDVAPAIASTAEYLLARSKTATWMKKEL*
Ga0070712_10171952113300006175Corn, Switchgrass And Miscanthus RhizosphereRAFGVRQLYLVTDGAQGYFGEKLGFQAVDRKDVAPEIAATAEYALARSKNATWMRKDL*
Ga0068871_10191760013300006358Miscanthus RhizosphereGFGAVDRKDVAPAITTTAEYLLARSKTATWMRKVL*
Ga0075428_10085664213300006844Populus RhizosphereDGAQGYFGEKLGFAAIDRKDVVAPIQATAEYALARSKAATWMRKEL*
Ga0111538_1235601113300009156Populus RhizosphereFGEKLGFLAIDRKDVAPAVAATAEYILARSKNATWMTKEL*
Ga0105248_1336925013300009177Switchgrass RhizosphereLVTDGAQGYFGEKLGFQAIDRKDVVAPIQATAEYALARSKNATWMRKEL*
Ga0105238_1145176713300009551Corn RhizosphereLFLVTDGAQGYFGERLGFAVIDRKDVDPKVTTTAEYMLARSKGATWMRKDL*
Ga0134124_1175740223300010397Terrestrial SoilYVLVEAATERARSQGVRQLFLVTDGAQGYFGEKLGFQVTDRKDVHPAVTTTAEYLLARSKTATWMRKIL*
Ga0126383_1263023413300010398Tropical Forest SoilLVTDGAQGYFGEKLGFHVVDRKDVAPEIAATAEYALARSKNATWMRKDL*
Ga0134127_1247188513300010399Terrestrial SoilLYLVTDGAQGYFGEKLGFAAVDRKEVAPAITTTAEYLLARSRTATWMRKIL*
Ga0134122_1155366323300010400Terrestrial SoilVTDGAQGYFGQRLGFVEVDRKDVDARIATTAEYLLARSKTAAWMRKSL*
Ga0134121_1265718523300010401Terrestrial SoilGFVEVDRKDVDARIATTAEYLLARSKTAAWMRKSL*
Ga0137421_115220123300012039SoilTDGAQGYFGEKLGFVAIDRKEIVAPIQATAEYALARSKAATWMRKEL*
Ga0137368_1015765333300012358Vadose Zone SoilGFSAIDRKDVAPEIAQTAEYLLARSKNATWMRKEL*
Ga0136635_1001349113300012530Polar Desert SandVETATNKARAEGVQRLYLVTDGAQGFFGEKVGFESIDRKEVDPALQTTVEYQMARNKAATWMRKVL*
Ga0137358_1093298523300012582Vadose Zone SoilFTAVDRKDVDAAITTTAEYLLARSKTATWMRKDLV*
Ga0136611_1025364023300012682Polar Desert SandYLVTDGAQGYFGERPGFQAIDRKDVDKAIQATGEYQMPRSKAATWMGKSL*
Ga0136614_1054014523300012684Polar Desert SandVTDSAHGFFGEKLGFETIDRKDVDPAIQTTVEYQMARNKTATWMRKVL*
Ga0137404_1047865823300012929Vadose Zone SoilGFVLVEAATYRARAQGVRQLYLVTDGAQGYFGEKLGFASVDRKDVDPGIAHTAEYLLARSKAATWMRKDL*
Ga0137410_1086650723300012944Vadose Zone SoilDGASGYFGEKLGFAAIDRKDIDAGIAQTAEYLLARSRAATWMRKDL*
Ga0137410_1108270923300012944Vadose Zone SoilLVTDGAQGYFGEKLGFTAVDRKDVDAAITTTAEYLLARSKTATWMRKDL*
Ga0126369_1087264723300012971Tropical Forest SoilRLYLVTDGAQGYFGEKLGFEAIDRKDVDPAITTTAEYQLARSRTATWMRKEL*
Ga0164308_1086089313300012985SoilQGYFGEKLGFQAIDRKDVVASIQATAEYALARSKNATWMRKEL*
Ga0157369_1226529023300013105Corn RhizosphereGVRHLYLVTDGAQGYFGERLGFQAVDRKDVVPEIAATAEYALARSKNATWMRKEL*
Ga0157372_1301559013300013307Corn RhizosphereQLYLVTDGAQGYFGEKLGFQVVARKDVAPEIAATAEYALARSKNATWMRKDL*
Ga0163163_1225418523300014325Switchgrass RhizosphereAQGYFGEKLGFVPVDRKDVAAPIAATAEYALARSKAATWMRKELG*
Ga0137409_1139206613300015245Vadose Zone SoilQLYLVTDGASGYFGEKLGFAAIDRKDIDAGIAQTAEYLLARSRAATWMRKDL*
Ga0132255_10153899323300015374Arabidopsis RhizosphereLGFVLVESATDRARSQGVNQLYLVTDGAQGYFGEKLGFVPVDRKDVAAPIAATAEYALARSKAATWMRKELG*
Ga0182032_1156836613300016357SoilLGFEAIDRKEVAAEVAATAEYALARSKNATWMRKELV
Ga0182034_1201761613300016371SoilATERARVQGVRQLYLVTDGAQGYFGERLGFTAIDRKDVVPEIASTAEYALARSKNATWMRKEL
Ga0184624_1014727523300018073Groundwater SedimentRSQGVRHLYLVTDGAQGYFGEKLGFTAIDRKDVAAAVAATAEYMLARSKNATWMTKEL
Ga0190275_1077022013300018432SoilRRLYLVTDGAQGYFGEKLGFAAVDRKDVHTSITTTAEYMLARSKTATWMQKEL
Ga0190270_1111380713300018469SoilFGEKLGFAAIDRKEVVAPIQATAEYALARSKAATWMRKEL
Ga0163151_1055574323300020057Freshwater Microbial MatVETAENKARSQGVRQLYLVTDGAQGYFGEKLGFETIDRKDCDPALMTTVEYQMARSRAATWMRKTL
Ga0213876_1074052023300021384Plant RootsTDGAQGYFGEKLGFQAIDRKDVVPEIAATAEYALARSKNATWMRKDL
Ga0210397_1065640423300021403SoilEKLGFVTVERKDIDAGIAQTAEFLLARSKAATWMRKEL
Ga0210389_1151247713300021404SoilFGVRQLYLVTDGAQGYFGEKLGFKVVDRKEVAPEIAATAEYALARSKNATWMRKDL
Ga0207697_1048040423300025315Corn, Switchgrass And Miscanthus RhizosphereSQGVRTLYLVTDGAQGYFGEKLGFGAVDRKDVAPAITTTAEYLLARSKTATWMRKVL
Ga0208357_108014113300025703Arctic Peat SoilTDGAQGYFGERLGFVAVDRKDVTAAIAATAEYALARSKNATWMRKEL
Ga0207707_1088627313300025912Corn RhizosphereDGAQNYFGEKLGFAAVDRKNVDAKVAATAEYMLARSKDATWMRKEL
Ga0207709_1158115713300025935Miscanthus RhizosphereQGYFGEKLGFTAIDRKDVAPAVAATAEYMLARSKNATWMTKEL
Ga0207689_1089002213300025942Miscanthus RhizosphereQSVRNLYLVTDGAQGYFGQRLGFAVVDRKDVDPKIATTAEYLLARSKNATWMRKEL
Ga0207668_1140715313300025972Switchgrass RhizosphereFGEKLGFTAIDRKDVAPAVAATAEYMLARSKNATWMTKEL
Ga0207640_1195266113300025981Corn RhizosphereRAFGVRQLYLVTDGAQGYFGEKLGFQAVDRKDVVAEVAATAEYALARSKNATWMRKEL
Ga0207678_1117428813300026067Corn RhizosphereQGYFGEKLGFAAIDRKDVVAPIQATAEYALARSKAATWMRKEL
Ga0207676_1101400013300026095Switchgrass RhizosphereRHLYLVTDGAQGYFGEKLGFTAIDRKDVVASIQATAEYNLARSKNATWMRKEL
Ga0179587_1096599223300026557Vadose Zone SoilEKLGFASVDRKDVDPGIAHTAEYLLARSKAATWMRKDL
Ga0209167_1039459323300027867Surface SoilGAQGYFGEKLGFVAIDRKDVDPSIAQTAEYLLARSKAATWMRKDL
Ga0209481_1071696413300027880Populus RhizosphereLGFAAIDRKDVVAPIQATAEYALARSKAATWMRKEL
Ga0265334_1015626323300028573RhizosphereRLYLVTDGAQGYFGERLGFAVVDRKEVDQKIATTAEYLLARSKEATWMRKEL
Ga0265336_1020021513300028666RhizosphereGEKLGFKVVDRKDVAAEIAATAEYALARSKNATWMRKDL
Ga0222749_1054805113300029636SoilYFGEKLGFVAVDRKDVDAGISQTAEYLLARSKAATWMRKDL
Ga0311332_1008424113300029984FenEAATARAHLFVVRQLYLVTDGAQGYFGEKLGFNVVDRKDVAAEIAATAEYALARSKNATWMRKDL
Ga0311349_1182442513300030294FenLLVETATERARSQGVHTLFLVTDGAQGYFGQRLGFAGVDRKDVDPRIASTAEYMLARSKDATWMRKAL
Ga0299914_1151626913300031228SoilRQLFLVTDGAQGYFGEKLGFETIDRKDVDPAVAGTVEYQMARSKAATWMRRVL
Ga0302323_10297187923300031232FenGAQGYFGEKLGFNVVDRKDVAAEIAATAEYALARSKNATWMRKDL
Ga0265339_1005363313300031249RhizosphereQGVRHLYLVTDGAQGYFGQKLGFQAAERKDVDPKIAGTAEYQLARSKNATWMHKEL
Ga0170819_1731805713300031469Forest SoilQGVRTLYLVTDGAQGYFGEKLGFVATDRKDVAQAIASTAEYLLARSKTAIWMKKEL
Ga0318555_1032854513300031640SoilLGYVLVEAATERARVQGVRQLYLVTDGAQGYFGERLGFTAIDRKDVVPEIASTAEYALARSKNATWMRKEL
Ga0302321_10302249713300031726FenDGAQGYFGQRLGFAGVDRKDVDPRIAATAEYMLARSKDATWMRKAL
Ga0318554_1036780623300031765SoilLYLVTDGAQGYFGEKLGFAAIDRKDVDPGIAQTAEYLLARSKAATWMRKEL
Ga0318546_1035988613300031771SoilLYLVTDGAQGYFGEKLGFQAIDRKEVAAEVAATAEYALARSKNATWMRKELV
Ga0318543_1004793233300031777SoilGYFGEKLGFEAIDRKEVAAEVAATAEYALARSKNATWMRKELV
Ga0318522_1026439623300031894SoilVLVEAATERARVQGVRQLYLVTDGAQGYFGERLGFTAIDRKDVVPEIASTAEYALARSKNATWMRKEL
Ga0307479_1210094013300031962Hardwood Forest SoilFRAIDRKDVDPAIATTAEYLLARSKTATWMRKDLV
Ga0306922_1088115223300032001SoilGVRQLYLVTDGAQGYFGEKLGFVAIDRKDVDAGIAQTAEYLLARSKNATWMRKDL
Ga0307416_10356910723300032002RhizosphereGYVLVAAATERARSQGVRHLYLVTDGAQGYFGEKLGFTAIDRKDVAPAVAATAEYMLARSKNATWMTKEL
Ga0310911_1051321123300032035SoilFGEKLGFEAIDRKEVAAEVAATAEYALARSKNATWMRKELV
Ga0318556_1072049823300032043SoilTDGAQGYFGEKLGFQAIDRKDVDAGIAQTAEYLLARSKNATWMRKDL
Ga0318553_1021535413300032068SoilHLYLVTDGAQGYFGEKLGFEAIDRKEVAAEVAATAEYALARSKNATWMRKELV
Ga0306920_10132997113300032261SoilLFLVTDGAQGYFGEKLGFSAIDRKDVDPAIAQTAEYLLARSKAATWMVKDL
Ga0335070_1123596423300032829SoilARTQGVRTLYLVTDGAQGYFGEKLGFVTTDRKDVAPAIASTAEYLLARSKTATWMKKEL
Ga0335076_1042171433300032955SoilYLVTDGAQGYFGEKLGFAAVDRKDVAPEIAATAEYALARSKSATWMRKEL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.