NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105564

Metagenome / Metatranscriptome Family F105564

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105564
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 44 residues
Representative Sequence VGTRRLTLLRHGKAQSIDACAEDFERALTRRGTIEAQEMA
Number of Associated Samples 85
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 78.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 95.00 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(19.000 % of family members)
Environment Ontology (ENVO) Unclassified
(27.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 27.94%    β-sheet: 8.82%    Coil/Unstructured: 63.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF00355Rieske 49.00
PF01883FeS_assembly_P 37.00
PF01592NifU_N 7.00
PF00266Aminotran_5 5.00
PF01458SUFBD 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0822Fe-S cluster assembly scaffold protein IscU, NifU familyPosttranslational modification, protein turnover, chaperones [O] 7.00
COG0719Fe-S cluster assembly scaffold protein SufBPosttranslational modification, protein turnover, chaperones [O] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.00 %
UnclassifiedrootN/A7.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004080|Ga0062385_10585533All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300004082|Ga0062384_100600085All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria745Open in IMG/M
3300004091|Ga0062387_101554033All Organisms → cellular organisms → Bacteria → Proteobacteria532Open in IMG/M
3300005537|Ga0070730_10273874All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300005541|Ga0070733_11200012All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300005591|Ga0070761_10173680All Organisms → cellular organisms → Bacteria → Proteobacteria1269Open in IMG/M
3300005610|Ga0070763_10148705All Organisms → cellular organisms → Bacteria → Proteobacteria1221Open in IMG/M
3300005712|Ga0070764_11037039All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300005921|Ga0070766_10671480All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae700Open in IMG/M
3300005995|Ga0066790_10523669All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300006050|Ga0075028_100429794All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300006102|Ga0075015_100144142All Organisms → cellular organisms → Bacteria → Proteobacteria1234Open in IMG/M
3300006176|Ga0070765_100872019All Organisms → cellular organisms → Bacteria → Proteobacteria851Open in IMG/M
3300006176|Ga0070765_100971013All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300006176|Ga0070765_101579782All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300006176|Ga0070765_102250037All Organisms → cellular organisms → Bacteria → Proteobacteria508Open in IMG/M
3300009500|Ga0116229_11079304All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria643Open in IMG/M
3300009522|Ga0116218_1212535All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria872Open in IMG/M
3300009632|Ga0116102_1163429All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria608Open in IMG/M
3300009698|Ga0116216_10122007All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1603Open in IMG/M
3300009709|Ga0116227_10174856All Organisms → cellular organisms → Bacteria → Proteobacteria1681Open in IMG/M
3300009709|Ga0116227_11230009All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria563Open in IMG/M
3300009709|Ga0116227_11410248All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria523Open in IMG/M
3300009764|Ga0116134_1063484All Organisms → cellular organisms → Bacteria → Proteobacteria1385Open in IMG/M
3300010859|Ga0126352_1135789All Organisms → cellular organisms → Bacteria → Proteobacteria837Open in IMG/M
3300011120|Ga0150983_15143352All Organisms → cellular organisms → Bacteria → Proteobacteria823Open in IMG/M
3300012683|Ga0137398_10833652All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria644Open in IMG/M
3300012929|Ga0137404_10245820All Organisms → cellular organisms → Bacteria → Proteobacteria1534Open in IMG/M
3300013314|Ga0175859_1073201All Organisms → cellular organisms → Bacteria → Proteobacteria1641Open in IMG/M
3300014201|Ga0181537_10876669All Organisms → cellular organisms → Bacteria → Proteobacteria608Open in IMG/M
3300014501|Ga0182024_10050025All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales6648Open in IMG/M
3300014502|Ga0182021_12532059All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria617Open in IMG/M
3300014657|Ga0181522_10559087All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria692Open in IMG/M
3300014657|Ga0181522_10789172All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria582Open in IMG/M
3300014658|Ga0181519_10194783All Organisms → cellular organisms → Bacteria → Proteobacteria1278Open in IMG/M
3300017823|Ga0187818_10357140All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria645Open in IMG/M
3300018022|Ga0187864_10284277All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria745Open in IMG/M
3300018035|Ga0187875_10626664Not Available566Open in IMG/M
3300019268|Ga0181514_1536088All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300020021|Ga0193726_1015483All Organisms → cellular organisms → Bacteria → Proteobacteria3974Open in IMG/M
3300020199|Ga0179592_10055568All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1803Open in IMG/M
3300020579|Ga0210407_10946460All Organisms → cellular organisms → Bacteria → Proteobacteria659Open in IMG/M
3300020582|Ga0210395_10154261All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1715Open in IMG/M
3300020582|Ga0210395_10435629All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria986Open in IMG/M
3300020582|Ga0210395_11139472All Organisms → cellular organisms → Bacteria → Proteobacteria575Open in IMG/M
3300021168|Ga0210406_10546899All Organisms → cellular organisms → Bacteria → Proteobacteria910Open in IMG/M
3300021168|Ga0210406_11058268All Organisms → cellular organisms → Bacteria → Proteobacteria600Open in IMG/M
3300021178|Ga0210408_10298604All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300021180|Ga0210396_10820146All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria797Open in IMG/M
3300021406|Ga0210386_10963622All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria729Open in IMG/M
3300021433|Ga0210391_10358257All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1144Open in IMG/M
3300021433|Ga0210391_10537383All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria918Open in IMG/M
3300021433|Ga0210391_11527868All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300021474|Ga0210390_10121380All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2190Open in IMG/M
3300022532|Ga0242655_10240006All Organisms → cellular organisms → Bacteria → Proteobacteria569Open in IMG/M
3300022533|Ga0242662_10038715All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1185Open in IMG/M
3300022726|Ga0242654_10037153All Organisms → cellular organisms → Bacteria1310Open in IMG/M
3300022726|Ga0242654_10088317All Organisms → cellular organisms → Bacteria → Proteobacteria954Open in IMG/M
3300024251|Ga0247679_1069691All Organisms → cellular organisms → Bacteria → Proteobacteria589Open in IMG/M
3300025463|Ga0208193_1024686All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1559Open in IMG/M
3300025913|Ga0207695_10264398All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1617Open in IMG/M
3300025939|Ga0207665_10600499All Organisms → cellular organisms → Bacteria → Proteobacteria859Open in IMG/M
3300026557|Ga0179587_11047848Not Available537Open in IMG/M
3300027609|Ga0209221_1149471Not Available581Open in IMG/M
3300027692|Ga0209530_1018183All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2131Open in IMG/M
3300027807|Ga0209208_10522678All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria550Open in IMG/M
3300027857|Ga0209166_10188041All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1114Open in IMG/M
3300027860|Ga0209611_10193302All Organisms → cellular organisms → Bacteria → Proteobacteria1250Open in IMG/M
3300027860|Ga0209611_10279745All Organisms → cellular organisms → Bacteria → Proteobacteria987Open in IMG/M
3300027884|Ga0209275_10445312Not Available734Open in IMG/M
3300028747|Ga0302219_10413561All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300028773|Ga0302234_10264906All Organisms → cellular organisms → Bacteria → Proteobacteria739Open in IMG/M
3300028906|Ga0308309_11120008All Organisms → cellular organisms → Bacteria → Proteobacteria680Open in IMG/M
3300029882|Ga0311368_10359177All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1084Open in IMG/M
3300029939|Ga0311328_10648175Not Available721Open in IMG/M
3300029945|Ga0311330_10331082All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1296Open in IMG/M
3300029951|Ga0311371_12392762All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria542Open in IMG/M
3300029952|Ga0311346_11415416All Organisms → cellular organisms → Bacteria → Proteobacteria525Open in IMG/M
3300029992|Ga0302276_10290694All Organisms → cellular organisms → Bacteria → Proteobacteria710Open in IMG/M
3300029993|Ga0302304_10382546All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300030013|Ga0302178_10518541All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300030503|Ga0311370_11347687All Organisms → cellular organisms → Bacteria → Proteobacteria759Open in IMG/M
3300030646|Ga0302316_10217418All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria782Open in IMG/M
3300030677|Ga0302317_10063821All Organisms → cellular organisms → Bacteria → Proteobacteria1816Open in IMG/M
3300030730|Ga0307482_1075012All Organisms → cellular organisms → Bacteria → Proteobacteria879Open in IMG/M
3300031090|Ga0265760_10048542All Organisms → cellular organisms → Bacteria1275Open in IMG/M
3300031128|Ga0170823_14805864All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300031231|Ga0170824_103522983All Organisms → cellular organisms → Bacteria → Proteobacteria520Open in IMG/M
3300031258|Ga0302318_10345986All Organisms → cellular organisms → Bacteria → Proteobacteria745Open in IMG/M
3300031524|Ga0302320_10532195Not Available1406Open in IMG/M
3300031671|Ga0307372_10471234All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria610Open in IMG/M
3300031708|Ga0310686_107914845All Organisms → cellular organisms → Bacteria → Proteobacteria576Open in IMG/M
3300031708|Ga0310686_116111803All Organisms → cellular organisms → Bacteria → Proteobacteria520Open in IMG/M
3300031715|Ga0307476_11296768Not Available532Open in IMG/M
3300031718|Ga0307474_10242845All Organisms → cellular organisms → Bacteria → Proteobacteria1378Open in IMG/M
3300031718|Ga0307474_11478239All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300031823|Ga0307478_10108800All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2157Open in IMG/M
3300031902|Ga0302322_102425064All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria646Open in IMG/M
3300033289|Ga0310914_10331852All Organisms → cellular organisms → Bacteria → Proteobacteria1374Open in IMG/M
3300034163|Ga0370515_0308367All Organisms → cellular organisms → Bacteria → Proteobacteria669Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil19.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil10.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa9.00%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated7.00%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog6.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.00%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.00%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.00%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.00%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.00%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%
Moss AssociatedHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Moss Associated1.00%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013314Moss microbial communities from three moss species from boreal forest in Fairbanks, Alaska, USA ReanalysisHost-AssociatedOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300025463Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027807Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes)Host-AssociatedOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027860Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)Host-AssociatedOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029992Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3EnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030677Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031671Soil microbial communities from Risofladan, Vaasa, Finland - OX-1EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062385_1058553313300004080Bog Forest SoilVDKRRLTLLRHGEAQPLDSSPEDFERILTRRGNIEAHDIAERIV
Ga0062384_10060008513300004082Bog Forest SoilVGTRRLTLLRHGQAQSIDACTEDFERALTRRGSIEAQEMAARIVYR
Ga0062387_10155403313300004091Bog Forest SoilVGTRRLTLLRHGKAEAADACPEDFERTLTHRGSIEAQQTASHLVKRDL
Ga0070730_1027387413300005537Surface SoilVGTRRLTLLRHGEAQPLDSCPEDFERALTRRGNIEAHEIAARIVHR
Ga0070733_1120001213300005541Surface SoilVGTLRLTLLRHGQAQPIDSCPEDFERALTRRGTIEAREMASR
Ga0070761_1017368013300005591SoilVDKRRLTLLRHGEAQALDTSPEDFERILTRRGNIEAHDIAERMVHH
Ga0070763_1014870513300005610SoilMRRLTLLRHGKAQSIDACAEDFERTLTRRGCIEAQ
Ga0070764_1103703913300005712SoilVGSRRLTLWRHGKAEPIDAYPEDYERPLTHRGCIEAQEMGSRLIKRNL
Ga0070766_1067148013300005921SoilVGTRRLTLLRHGKAQSIDACAEDFERTLTRRGCIEAQEMATRIVYRDLI
Ga0066790_1052366923300005995SoilVGTLRLTLLRHGQAQPIDTCTEDFERALTHRGTIETKEIAARIVARNLAPDLILVS
Ga0075028_10042979413300006050WatershedsVGTRRLTLIRHGKAEVIDAYPEDFERALSHRGGIEAQEMATRLLKRNLV
Ga0075015_10014414213300006102WatershedsVGTRRLTLLRHGKAEPADASPEDFERALTHRGSIEAQKMATHLV
Ga0070765_10087201913300006176SoilVGTRRLTLLRHGTAEAADACAEDFERALTRRGTIEAREIAMCI
Ga0070765_10097101313300006176SoilVGTRRLTLLRHGKAQSIDSCAEDFERALARRGGIEAREM
Ga0070765_10157978213300006176SoilVGTRRLTLLRHGKAEAVDAYPEDYERPLTHRGSIEAQEMATR
Ga0070765_10225003713300006176SoilVGTRRLTLLRHGKAQSIDACAEDFERALTRRGTIEAREMAK
Ga0116229_1107930413300009500Host-AssociatedVDTRRLTLLRHGEAQALDTSPEDFERTLTRRGNIEAHEIAERIV
Ga0116218_121253513300009522Peatlands SoilVGTRRLTLLRHGQAQTIDTCTEDFERQLTRRGSIEAQEMAARLVYRNLVPD
Ga0116102_116342913300009632PeatlandVGPLRLTLLRHGQAHAIDSCPEDFERTLTRRGAVEAQEMASRLVYRHLIPDL
Ga0116216_1012200713300009698Peatlands SoilVGTRRLTLLRHGQAQTIDTCTEDFERQLTRRGSIEAQEMA
Ga0116227_1017485653300009709Host-AssociatedLLRHGEAQALDSCPEDFERALTRRGNIEAQEIATRIV
Ga0116227_1123000933300009709Host-AssociatedVGPRRLTLLRHGQAQPIDSCAEDFERELTRRGIIEAQEI
Ga0116227_1141024813300009709Host-AssociatedLLRHGQAEPVDSCREDFERALTRRGLIEAREMAAR
Ga0116134_106348443300009764PeatlandMRRLTLLRHAQAQPIDTCAEDFERALTRRGCIEAREMAARIVYRNLIPDLILV
Ga0126352_113578913300010859Boreal Forest SoilVGTRRLTLLRHGKAQSIDACAEDFERALTHRGTIEAREM
Ga0150983_1514335233300011120Forest SoilVGSRRLTLLRHGKAQSVDACAEDYERALTRRGCIEAQEMAARIVQRDLI
Ga0137398_1083365213300012683Vadose Zone SoilVGTLRLTLLRHGQAQAIDSCPEDFERILTRRGTIEAKEMAMRIVHRDLIPD
Ga0137404_1024582013300012929Vadose Zone SoilLRHGKAQSIDACAEDFERALTRRGTIEAREMAMRIVYRGLIP
Ga0175859_107320153300013314Moss AssociatedVDTRRLTLLRHGEAQALDTSPEDFERTLTRRGNIEAH
Ga0181537_1087666933300014201BogVGTLRLTLLRHGEAQALDSCPEDFERTLTRRGCIEAQ
Ga0182024_1005002513300014501PermafrostMGTRRVTLLRHGQAQASDTCAEDFERQLTRRGSVEAREIAVRVVYLRLIPDLILVSPDERAW
Ga0182021_1253205913300014502FenLRHGKAQSIDSCAEDFERALTRRGCIEVQEMAARLVYRELIPDLI
Ga0181522_1055908713300014657BogVDKRRLTLLRHGEAQALDTSPEDFERTLTRRGNVEAHDIAERIVHH
Ga0181522_1078917233300014657BogVDTRRLTLLRHGEAQALDTSPEDFERTLTRRGNVEAQEIAERIV
Ga0181519_1019478313300014658BogVGTRRLTLVRHGKAQSIDACAEDFERALTRRGTIEVREVAMRIVSRDLIPDLI
Ga0187818_1035714013300017823Freshwater SedimentMGTLRLTLLRHGQAQTIDSCPEDFERPLTRRGCVEAQEMAARI
Ga0187864_1028427733300018022PeatlandVGPLRLTLLRHGQAHAIDSCPEDFERTLTRRGAVEAQE
Ga0187875_1062666413300018035PeatlandVTTVGARRLTLLRHGEAQAPDSCPEDFERALTRHGANEARAIGERILRSNLIPDLIL
Ga0181514_153608813300019268PeatlandVGTHRLTLLRHGKAESIDDCAEDFERALTHRGTLEAQEMAKRIVQRDLVPDLM
Ga0193726_101548313300020021SoilVGTLRLTLLRHGKAEPADAHPEDYERPLAHRGCIEAQEMA
Ga0179592_1005556853300020199Vadose Zone SoilVGTRRLTLLRHGKAQSIDACAEDFERALTRRGTIEAR
Ga0210407_1094646033300020579SoilVGTRRLTLLRHGKAQSVDACAEDFERALTRRGCIEAQEMAARIVHRDL
Ga0210395_1015426113300020582SoilVGTRRLTLLRHGTAEAADACAEDFERALTRRGTIEAREIAMCIVQRDLIPD
Ga0210395_1043562913300020582SoilVGPRRLTLLRHGKAEAVDAYPEDYERPLTHRGGIEAQEMALRLV
Ga0210395_1113947233300020582SoilVGPRRLTLLRHGKAEAVDACPEDFERALTHRGSIEAQNMATRLVQRNLIPD
Ga0210406_1054689913300021168SoilVGTRRLTLLRHGKAQSIDACVEDFERALTRRGNIEAREMAMRIV
Ga0210406_1105826813300021168SoilVGTRRLTLLRHGKAQSIDACAEDFERALTRRGCIEAQ
Ga0210408_1029860413300021178SoilVGTRRLTLLRHGKAQSIDACAEDFERVLTRRGTIEA
Ga0210396_1082014613300021180SoilVDTRRLTLLRHGEAQALDSSPEDFERTLTRRGNVEAHEI
Ga0210386_1096362233300021406SoilVGTRRLTLLRHGKAQSIDACAEDFERTLTRRGTIEAREMAK
Ga0210391_1035825743300021433SoilVDTRRLTLLRHGEAQALDSSPEDFERTLTRRGNVEAHEIAE
Ga0210391_1053738333300021433SoilVVARRLTLLRHGEAQALDSCPEDFERALTRRGVIEAQEIAERIVR
Ga0210391_1152786813300021433SoilVGTRRLTLLRHGTAEAADACAEDFERALTRRGTIEAREIAMCIVQRD
Ga0210390_1012138013300021474SoilVGTLRLTLLRHGEAQALDSCPEDFERALTRRGNIEAHEIAARIVHRDLV
Ga0242655_1024000633300022532SoilVGTRRLTLLRHGKAEAADSSPEDFERALTHRGSIEAQKMATHLM
Ga0242662_1003871543300022533SoilVGTRRLTLLRHGKAEAADAYPEDYERPLTHRGVIEAQEMA
Ga0242654_1003715343300022726SoilVGTRRLTLLRHGKAQSIDACAEDFERALTRRGTIEAQEMA
Ga0242654_1008831713300022726SoilVGTRRLTLLRHGKAEAVDAYPEDYERPLTHLGSIEAQEMATRLVKRNLV
Ga0247679_106969113300024251SoilVGARRLTLLRHGKAQPIDACAEDFERALTRRGCIEAQEMAARIV
Ga0208193_102468613300025463PeatlandVGPRRLTLLRHGQAQPIDSCAEDFERELTRRGIIEAQEIAARILQRNL
Ga0207695_1026439813300025913Corn RhizosphereVGTRRLTLLRHGKAQSIDACAEDFERALSRRGAIEAREIAARIVARDLIPDLI
Ga0207665_1060049933300025939Corn, Switchgrass And Miscanthus RhizosphereVGARRLTLLRHGKAQPIDACAEDFERALTRRGCIEAQEMAARIVY
Ga0179587_1104784823300026557Vadose Zone SoilVGTRRLTLLRHGKAQSIDSCVEDFERALTRRGSIEAQEMAARIVRRDL
Ga0209221_114947123300027609Forest SoilVVARRLTLLRHGEAQALDSCPEDFERALTRRGVVEAQEIAERI
Ga0209530_101818353300027692Forest SoilVGTRRLTLLRHGKAEAVDAYPEDYERPLTHRGCIEAQEMASRLVK
Ga0209208_1052267813300027807Host-AssociatedVGPRRLTLLRHGHAQPIDSCAEDFERELTRRGTIEAQEIG
Ga0209166_1018804133300027857Surface SoilVGTRRLTLLRHGEAQPLDSCPEDFERALTRRGNIEAHEIAARIVHRD
Ga0209611_1019330243300027860Host-AssociatedVGPRRLTLLRHGHAQPIDSCAEDFERELTRRGTIEAQEIGARLLQRDL
Ga0209611_1027974513300027860Host-AssociatedVDTRRLTLLRHGEAQALDTSPEDFERTLTRRGNIEAHEIAE
Ga0209275_1044531213300027884SoilVVTRRLTLLRHGEAQALDSCPEDFERTLTRRGTIEAQEIAERIVRRNLIPD
Ga0302219_1041356123300028747PalsaVDKRRLTLLRHGEAQALDSSPEDFERILTRRGNIEAHDIAERIVHHRLIPDLI
Ga0302234_1026490613300028773PalsaVDTRRLTLLRHGEAQALDSSPEDFERTLTRRGNIEAHEIAE
Ga0308309_1112000833300028906SoilVGTRRLTLLRHGKAEAVDAYPEDYERPLTHRGCIEAQE
Ga0311368_1035917733300029882PalsaVDKRRLTLLRHGEAQALDTSPEDFERTLTRRGNVEAHDIAERIVHHRLIP
Ga0311328_1064817513300029939BogVTTMVARRVTLLRHGEAQAPDSCPEDFERALTRHGANEARAIGERILRRNLIPDLI
Ga0311330_1033108243300029945BogMVARRVTLLRHGEAQAPDSCPEDFERALTRHGANEARA
Ga0311371_1239276213300029951PalsaVGTLRLTLLRHGKAEAADAYPEDFERPLTHRGGIEVQEMAKRL
Ga0311346_1141541613300029952BogVGTRRLTLLRHGKAQSIDSCAEDFERTLARRGSIEAQEMANRIVY
Ga0302276_1029069433300029992BogVGTRRLTLLRHGEAQAPEAYAEDFERPLTRRGGIEAREMGTL
Ga0302304_1038254623300029993PalsaVGTRRLTLLRHGKAEAVDAYPEDYERPLTHRGCIEAQEMASR
Ga0302178_1051854113300030013PalsaVGTRRLTLLRHGKAEPIDACAEDFERALTHRGSIEAREMASRILHRDLIPD
Ga0311370_1134768713300030503PalsaVGTLRLTLLRHGEAQALDSCPEDFERALTRRGNIEAHEI
Ga0302316_1021741813300030646PalsaVDTRRLTLLRHGEAQPLDSSPEDFERVLTRRGNVEAHDIAERIV
Ga0302317_1006382113300030677PalsaVGTPKLTLTLLRHGEAQPIDSCPEDFERALTKRGTA
Ga0307482_107501233300030730Hardwood Forest SoilVGTRRLTLLRHGKAEAVDAYPEDYERPLTHRGCIEAQEMASRLVKRD
Ga0265760_1004854243300031090SoilMRRLTLLRHGKAQSIDACAEDFERTLTRRGCIEAQEMAMRIVYR
Ga0170823_1480586413300031128Forest SoilVGTLRLTLLRHGQAQAVDSCPDDFERLLTRRGAIEAKEMATRIVHRDL
Ga0170824_10352298313300031231Forest SoilVGTRRLTLLRHGKAEAADAYPEDYERPLTHRGIIEAQEMAARLVKR
Ga0302318_1034598633300031258BogMGTRRLTLLRHGEAQPGDSCPEDFERALTRRGRSEAREMAVRVAHQRLVPDLIL
Ga0302320_1053219543300031524BogVTTAVTRRVTLLRHGEAQAPDSCPEDFERALTRHGANEARAIGERILRRNLIPDLILV
Ga0307372_1047123433300031671SoilMGAHRRLTLLRHGQAASADAYAEDFERPLTRHGIREAEEMAKRLI
Ga0310686_10791484533300031708SoilVGTRRLTLLRHGKAQSIDACVEDFERALARRGSIEAQEMANR
Ga0310686_11611180323300031708SoilVGTRRLTLLRHGIAQSIDACAEDFERALTHRGGIEVREMAARIVRRDL
Ga0307476_1129676823300031715Hardwood Forest SoilVVARRLTLLRHGEAQALDSCPEDFERALTRRGVIEAQEIA
Ga0307474_1024284513300031718Hardwood Forest SoilVGTRRLTLLRHGKAQSIDACAEDFERALTRRGSIEAREMAMRIVYRDLI
Ga0307474_1147823933300031718Hardwood Forest SoilVGTRRLTLLRHGEAQALDSCPEDFERALTRRGNIEAHE
Ga0307478_1010880013300031823Hardwood Forest SoilVGTRRLTLLRHGKAQSIDACAEDFERALTRRGTIEAREMAMR
Ga0302322_10242506413300031902FenVGARRLTLFRHGQAESPDAWADDFERPLTRRGTEEVREMASRL
Ga0310914_1033185213300033289SoilLGTRRVTLLRHGKAEVIDAYPEDFERALTHRGGIEAQEMG
Ga0370515_0308367_2_1093300034163Untreated Peat SoilMGTRRLTLLRHGKAEAADAYPEDFERPLTHRGGIEV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.