Basic Information | |
---|---|
Family ID | F105466 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 49 residues |
Representative Sequence | MSWKYFIGASILATGLLIKVGAPLVPVVMGIALAAFFNWRRERRATVKR |
Number of Associated Samples | 84 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.00 % |
% of genes near scaffold ends (potentially truncated) | 31.00 % |
% of genes from short scaffolds (< 2000 bps) | 90.00 % |
Associated GOLD sequencing projects | 74 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.84% β-sheet: 0.00% Coil/Unstructured: 44.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF00909 | Ammonium_transp | 15.00 |
PF13428 | TPR_14 | 2.00 |
PF14622 | Ribonucleas_3_3 | 2.00 |
PF13489 | Methyltransf_23 | 2.00 |
PF00543 | P-II | 2.00 |
PF00999 | Na_H_Exchanger | 2.00 |
PF00892 | EamA | 2.00 |
PF09594 | GT87 | 1.00 |
PF01451 | LMWPc | 1.00 |
PF01568 | Molydop_binding | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 15.00 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 2.00 |
COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 2.00 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 2.00 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 2.00 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 2.00 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 2.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.00 % |
Unclassified | root | N/A | 15.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000550|F24TB_12255330 | Not Available | 755 | Open in IMG/M |
3300000956|JGI10216J12902_116922801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300004114|Ga0062593_100692196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 992 | Open in IMG/M |
3300004156|Ga0062589_100529064 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300004156|Ga0062589_102017112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 585 | Open in IMG/M |
3300004157|Ga0062590_100057860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2202 | Open in IMG/M |
3300005169|Ga0066810_10109268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 622 | Open in IMG/M |
3300005290|Ga0065712_10212963 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
3300005294|Ga0065705_10620667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 695 | Open in IMG/M |
3300005332|Ga0066388_101498508 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300005334|Ga0068869_100571772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 952 | Open in IMG/M |
3300005337|Ga0070682_101193277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 642 | Open in IMG/M |
3300005337|Ga0070682_101402912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 597 | Open in IMG/M |
3300005338|Ga0068868_101095689 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300005338|Ga0068868_101860973 | Not Available | 569 | Open in IMG/M |
3300005345|Ga0070692_11283084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 524 | Open in IMG/M |
3300005354|Ga0070675_100440794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1167 | Open in IMG/M |
3300005354|Ga0070675_100625311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 978 | Open in IMG/M |
3300005356|Ga0070674_100500435 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300005367|Ga0070667_101007824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 777 | Open in IMG/M |
3300005456|Ga0070678_100896155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 811 | Open in IMG/M |
3300005549|Ga0070704_102195637 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005719|Ga0068861_101089908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 767 | Open in IMG/M |
3300005841|Ga0068863_100526213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1166 | Open in IMG/M |
3300005843|Ga0068860_100366654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1420 | Open in IMG/M |
3300006196|Ga0075422_10130395 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300006237|Ga0097621_101194703 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300006844|Ga0075428_100289444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1762 | Open in IMG/M |
3300006845|Ga0075421_102544941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 532 | Open in IMG/M |
3300006846|Ga0075430_100291691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1349 | Open in IMG/M |
3300006880|Ga0075429_101105765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 692 | Open in IMG/M |
3300006904|Ga0075424_100800554 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300006954|Ga0079219_10462469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 871 | Open in IMG/M |
3300009012|Ga0066710_104108360 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300009098|Ga0105245_12487814 | Not Available | 571 | Open in IMG/M |
3300009162|Ga0075423_11980518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
3300009176|Ga0105242_11770077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
3300009177|Ga0105248_10427532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1491 | Open in IMG/M |
3300009177|Ga0105248_13303862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300009551|Ga0105238_11080515 | Not Available | 825 | Open in IMG/M |
3300009553|Ga0105249_10420943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1369 | Open in IMG/M |
3300010047|Ga0126382_11495372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
3300010403|Ga0134123_10344375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1343 | Open in IMG/M |
3300010403|Ga0134123_12777600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300011423|Ga0137436_1092878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
3300012212|Ga0150985_116968568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300012232|Ga0137435_1054412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
3300012469|Ga0150984_112462414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300012893|Ga0157284_10349005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300012955|Ga0164298_10955477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
3300012957|Ga0164303_11335442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300012960|Ga0164301_11693626 | Not Available | 528 | Open in IMG/M |
3300012961|Ga0164302_11444630 | Not Available | 564 | Open in IMG/M |
3300013308|Ga0157375_10608716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1251 | Open in IMG/M |
3300013308|Ga0157375_13425596 | Not Available | 528 | Open in IMG/M |
3300013308|Ga0157375_13630884 | Not Available | 513 | Open in IMG/M |
3300015371|Ga0132258_10191439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4955 | Open in IMG/M |
3300015371|Ga0132258_12244763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1370 | Open in IMG/M |
3300015372|Ga0132256_100756623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
3300015374|Ga0132255_100058888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5048 | Open in IMG/M |
3300015374|Ga0132255_104359549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300015374|Ga0132255_106282894 | Not Available | 503 | Open in IMG/M |
3300018067|Ga0184611_1006825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3068 | Open in IMG/M |
3300018067|Ga0184611_1154879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
3300018073|Ga0184624_10024824 | Not Available | 2270 | Open in IMG/M |
3300018074|Ga0184640_10481188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300018075|Ga0184632_10313776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
3300018083|Ga0184628_10038316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2405 | Open in IMG/M |
3300018476|Ga0190274_10018217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4551 | Open in IMG/M |
3300019362|Ga0173479_10083829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1140 | Open in IMG/M |
3300025315|Ga0207697_10351037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
3300025925|Ga0207650_11156042 | Not Available | 659 | Open in IMG/M |
3300025926|Ga0207659_10141072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1871 | Open in IMG/M |
3300025927|Ga0207687_10646173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
3300025930|Ga0207701_10016907 | All Organisms → cellular organisms → Bacteria | 7053 | Open in IMG/M |
3300025930|Ga0207701_10364865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1247 | Open in IMG/M |
3300025934|Ga0207686_10332445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1139 | Open in IMG/M |
3300025937|Ga0207669_11802573 | Not Available | 523 | Open in IMG/M |
3300025941|Ga0207711_10477149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
3300025941|Ga0207711_11502180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300025961|Ga0207712_10411658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1139 | Open in IMG/M |
3300025986|Ga0207658_10938162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
3300026118|Ga0207675_102082720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300027523|Ga0208890_1086828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300028380|Ga0268265_10737062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
3300028587|Ga0247828_10660015 | Not Available | 646 | Open in IMG/M |
(restricted) 3300031150|Ga0255311_1024142 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
3300031184|Ga0307499_10106738 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300031538|Ga0310888_10310054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
3300031547|Ga0310887_10419682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 791 | Open in IMG/M |
3300031740|Ga0307468_101152780 | Not Available | 695 | Open in IMG/M |
3300031740|Ga0307468_101696238 | Not Available | 594 | Open in IMG/M |
3300031740|Ga0307468_102005465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300031944|Ga0310884_10014370 | All Organisms → cellular organisms → Bacteria | 3051 | Open in IMG/M |
3300032012|Ga0310902_10038615 | All Organisms → cellular organisms → Bacteria | 2257 | Open in IMG/M |
3300032075|Ga0310890_11419966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300032157|Ga0315912_10767503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
3300034354|Ga0364943_0061085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1263 | Open in IMG/M |
3300034666|Ga0314788_030045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
3300034667|Ga0314792_030777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.00% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 6.00% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.00% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.00% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
F24TB_122553302 | 3300000550 | Soil | MSWKLFVGASILSAGLLIKVDAPLIPLLLGIALAAFVNHKRQRNAVAKR* |
JGI10216J12902_1169228011 | 3300000956 | Soil | MSWKYFIGASILATGLLVKIGAPLVPVALGIAMAAFFNWRREHRSAAKR* |
Ga0062593_1006921962 | 3300004114 | Soil | MSWKYFVGASILATGLLIKIGAPLVPLALGVSMAAVFNWQLHRRS* |
Ga0062589_1005290642 | 3300004156 | Soil | MSWKLFVGASILSAGLLIKIGAPLVPIALGIAGAAFVNRWRQRSATAKR* |
Ga0062589_1020171122 | 3300004156 | Soil | MSWKLFVGATILSAGLLIKAGAPLVPLVMGIAMAAFFNHWRQRGAIGKRRADPPS* |
Ga0062590_1000578601 | 3300004157 | Soil | MNWKFFVGASILATGLLIKVGAPLVPLAIGIAMAALVNWRRGLQRDRRHLP* |
Ga0066810_101092682 | 3300005169 | Soil | MNWKFFTGATILAVGLLIKIGAPLVPVAIGVAMAAMINWRRERRATVKR* |
Ga0065712_102129632 | 3300005290 | Miscanthus Rhizosphere | MSWRLFIGASILATGLLIKVGAPLVPVVMGIAMAAVFNWRRERRANSRN* |
Ga0065705_106206671 | 3300005294 | Switchgrass Rhizosphere | MSWRLFIGASILATGVLIKVGAPLVPVVMGIAMAAFFNWRRERRANPRR |
Ga0066388_1014985083 | 3300005332 | Tropical Forest Soil | MSWKFFGGASILVTGLLIKVGALLVPIALGISMAAFCNWLLHRRSAAKR* |
Ga0068869_1005717721 | 3300005334 | Miscanthus Rhizosphere | MSWKLFVGASILSAGLLIKAGAPLVPLVMGIAMAAFFNHWRQ |
Ga0070682_1011932771 | 3300005337 | Corn Rhizosphere | MSWKYFMGASILATGLLVKVGAPLVSLALGISMAAFCNWQLHRLSAAKR* |
Ga0070682_1014029121 | 3300005337 | Corn Rhizosphere | MSWKFFIGASILAAALLIKVGAPLIPVALAIVLVAVFNWQRARRTAVKR* |
Ga0068868_1010956891 | 3300005338 | Miscanthus Rhizosphere | MSWKLFVGASILSVGLLIKAGAPLMPLVMGIAIAAFFNHWRQRGAIGKRRADPPS* |
Ga0068868_1018609731 | 3300005338 | Miscanthus Rhizosphere | GASILSAGLLIKVGAPLVTVVMGIAMAAFFNHRRQRGATAKR* |
Ga0070692_112830841 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MNWRLFIGASILATGLLIKVGAPLIPVVMGIAMAAFFNWRRERRATAKR* |
Ga0070675_1004407942 | 3300005354 | Miscanthus Rhizosphere | MSWKYFVGASILAAGLLIKVGAPLVPVALGIALAAFFNWRREHRAPAKR* |
Ga0070675_1006253113 | 3300005354 | Miscanthus Rhizosphere | MSWRLFIGASILATGLLIKVGAPLIPVVMGIAMAAFFNWRRERRANARR* |
Ga0070674_1005004352 | 3300005356 | Miscanthus Rhizosphere | MSWRLFIGASILATGLLIKVGAPLVPVVMGIAMAAFFNWRRERRANFRR* |
Ga0070667_1010078241 | 3300005367 | Switchgrass Rhizosphere | MSWKLFVGASILSAGLLIKIGAPLVPIALGIAGAAFVNRWRQRGATAKR* |
Ga0070678_1008961552 | 3300005456 | Miscanthus Rhizosphere | MNWRLFIGASILATGLLIKVGAPLIPVVMGIAMAAFFNWRRERRANSRR* |
Ga0070704_1021956371 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKWKFFIGACILASGLLFKAGAPLLPVVMGIAMAAFVNWRTQRRE* |
Ga0068861_1010899082 | 3300005719 | Switchgrass Rhizosphere | VGASILSAGLLIKAGAPLVAVIMGIALAAFFNHRRQRGESAKR* |
Ga0068863_1005262132 | 3300005841 | Switchgrass Rhizosphere | MSWKLFVGASILSAGLLIKVGAPLVPVALGIAGAAFVNRWRQRAATAKR* |
Ga0068860_1003666543 | 3300005843 | Switchgrass Rhizosphere | MSWKLFVGASILSVGLLIKAGAPLMPLVMGIAMAAFFNYRRQRGAIGKHRADPPS* |
Ga0075422_101303952 | 3300006196 | Populus Rhizosphere | MSWKLFVGASILSAGLLIKVDAPLIPVLLGIALAAFVNHKRQRGAVAKR* |
Ga0097621_1011947032 | 3300006237 | Miscanthus Rhizosphere | MSWKLFVGASILSAGLLIKVGAPLVTVVMGIAMAAFFNHRRQRGATARR* |
Ga0075428_1002894442 | 3300006844 | Populus Rhizosphere | MSWKLFVGASILSAGLLIKVGAPLIPLLLGIALAAFVNHKRQRNAVAKR* |
Ga0075421_1025449412 | 3300006845 | Populus Rhizosphere | MSWKLFVGASILSAGLLIKVDAPLIPVLLGIALAAFVNHKRQRNAVAKR* |
Ga0075430_1002916913 | 3300006846 | Populus Rhizosphere | MSWRLFVGASILATGLLIKVGAPLVPVLMGIAMAAFFNW |
Ga0075429_1011057652 | 3300006880 | Populus Rhizosphere | MSWKLFVGASILSAGLLIKVGAPLIPLLLGIALAAFVNHKRQR |
Ga0075424_1008005542 | 3300006904 | Populus Rhizosphere | MTWKYFTGASILVTGLLIKVGAPVVPLALGISMAAFCNWQLHRRSAAKR* |
Ga0079219_104624692 | 3300006954 | Agricultural Soil | ATILSVGLLIKIGAPLIPIGVGIALAAFVNYRRQRTAMSK* |
Ga0066710_1041083601 | 3300009012 | Grasslands Soil | WKYFIGATILACGLLIKAGAPLIPVALGVGLAALFNWSRVRRA |
Ga0105245_124878142 | 3300009098 | Miscanthus Rhizosphere | MSWKYFIGASILATGLLIKVGAPLVPVVMGIALAAFFNWRRERRATVKR* |
Ga0075423_119805182 | 3300009162 | Populus Rhizosphere | MTWKYFTGASILVTGLLIKVGAPVVPLAVGITIAAFCNWQLHRRSAAKR* |
Ga0105242_117700772 | 3300009176 | Miscanthus Rhizosphere | MQMNWKYFVGASILAVGLLIKVGAPVVPIAVGIAGAAYFNYRKQRRLAPLPKKT* |
Ga0105248_104275323 | 3300009177 | Switchgrass Rhizosphere | MSWKFFIGASILSAGLLIKVGAPLVPVVVGIAMAAFVNHWRQRGQPARR* |
Ga0105248_133038621 | 3300009177 | Switchgrass Rhizosphere | MSWKYFVGASILAAGLLIKVGAPIVPVALGIAMAAFFNWRREHRATAKR* |
Ga0105238_110805152 | 3300009551 | Corn Rhizosphere | MSWKYFLCASILGTGLLLKAGAPLVPLALGISLAALCNWQLHRRSAAKH* |
Ga0105249_104209432 | 3300009553 | Switchgrass Rhizosphere | MSWKLFVGASILSVGLLIKAGAPLMPLVMGIAIAAFFNRWRQRGAIGKRRADPPS* |
Ga0126382_114953721 | 3300010047 | Tropical Forest Soil | MSWKYFVGASILATGLLIKVGAPLVPLVLGISMAAFCNWQLHRRSATKR* |
Ga0134123_103443751 | 3300010403 | Terrestrial Soil | MSWKYFVGASILATGLLIKIGAPLVPLALGVSMAAV |
Ga0134123_127776001 | 3300010403 | Terrestrial Soil | MSWKLFVGASILSAGLLIKVGAPVIPVVLGIVMAAFVNHRRQRA |
Ga0137436_10928782 | 3300011423 | Soil | MNWKFFTGATILAVGLLIKIGAPLVPVVIGVAMAGMFNWRRERRVTVKR* |
Ga0150985_1169685681 | 3300012212 | Avena Fatua Rhizosphere | MSWKYFVGASILATGLLIKIGAPLVPVALGIAMAAFFNWRRGQSATAKR* |
Ga0137435_10544122 | 3300012232 | Soil | MSWKLFIGSSILVTALLIKAGAPLVPVAMGVAVAAFFNWWRERRRARVKR* |
Ga0150984_1124624141 | 3300012469 | Avena Fatua Rhizosphere | MSWKYFVGASILATGLLIKIGAPLVPVALGIAMAAFFNWRRGQRATAKR* |
Ga0157284_103490051 | 3300012893 | Soil | MSWRLFIGASILATGLLIKVGAPLVPVVMGIAMAAFFNWRR |
Ga0164298_109554771 | 3300012955 | Soil | MSWKYFMGASILATGLLVKVGAPLVSLALGISMAAFCNWQLH |
Ga0164303_113354421 | 3300012957 | Soil | TGLLIKVGAPLVPVVMGVAMAAVFNWLRERRATAKR* |
Ga0164301_116936262 | 3300012960 | Soil | MSWKYFMSASILATGLLVKVGAPLVSLALGISMAAFCNWRLHRLSAAKR* |
Ga0164302_114446301 | 3300012961 | Soil | MSWKFFIGASILATGLLIKVGAPLVPVVVGVAMAAGFNWLRERRATAKR* |
Ga0157375_106087162 | 3300013308 | Miscanthus Rhizosphere | FVGASILSAGLLIKVGSPVMPVILGIAMAAFVNYRRHRDATAKR* |
Ga0157375_134255962 | 3300013308 | Miscanthus Rhizosphere | MSWKFFIGASILSAGLLIKVGAPLVPVVVGIAMAAFVNHWRQRGEPARR* |
Ga0157375_136308842 | 3300013308 | Miscanthus Rhizosphere | WKYFVGASILAAGLLIKVGAPLVPVALGIALAAFFNWRREHRAPAKR* |
Ga0132258_101914394 | 3300015371 | Arabidopsis Rhizosphere | MSWKYFAGASILVTGLLIKVGAPLVPLALGISMAALCNWQLHRRSAAKR* |
Ga0132258_122447631 | 3300015371 | Arabidopsis Rhizosphere | MSWKLFIGASILSAGLLIKVGAPLIPVVLGIVMAAFVNHRRQRGVIAKR* |
Ga0132256_1007566231 | 3300015372 | Arabidopsis Rhizosphere | MSWKYFVGASILATGLLIKIGAPLVPIALGIAMAAFFNWQLHRRS* |
Ga0132255_1000588881 | 3300015374 | Arabidopsis Rhizosphere | MSWKYFVGASILATGLLIKIGAPLVPVALGIAMAAFFNWRRGQRATTAKR* |
Ga0132255_1043595492 | 3300015374 | Arabidopsis Rhizosphere | MSWRLFIGASILATGLLIKVGAPLVPVVMGIAMAAFFNWRRERRANSRR* |
Ga0132255_1062828941 | 3300015374 | Arabidopsis Rhizosphere | LVLVGASILSAGLLIKAGAPLVPLVMGIAMAAFFNHWRQRGALGKRRADPPS* |
Ga0184611_10068254 | 3300018067 | Groundwater Sediment | MSWRLFIGASILATGLLIKVGAPLIPVAMGIAMAAFFNWRRERRANSRR |
Ga0184611_11548791 | 3300018067 | Groundwater Sediment | MNWKFFIGASILATGLLIKVGAPLVPLAIGIAMAGLVNWRRGIRRDRRQSSGA |
Ga0184624_100248242 | 3300018073 | Groundwater Sediment | MNWKFFIGASILATGLLIKVGAPLVPLAIGIAMAALVNWRRGIRRDRRQSSGA |
Ga0184640_104811881 | 3300018074 | Groundwater Sediment | DVEMSWRLFIGASILATGLLIKVGAPLIPVAMGIAMAAFFNWRRERRANSRR |
Ga0184632_103137761 | 3300018075 | Groundwater Sediment | MSWKFFVGASILATGLLIKVGAPLVPVAMGIAMAASFNWWRQRRASARR |
Ga0184628_100383164 | 3300018083 | Groundwater Sediment | MNWKFFIGASILATGLLIKVGAPLVPLAIGIAMAALVNWRRGLRRDRRQSSGSGA |
Ga0190274_100182172 | 3300018476 | Soil | MNWKFFVGASILATGLLIKVGAPLVPLAIGIAMAALVNWRRGLQRDRRHLP |
Ga0173479_100838292 | 3300019362 | Soil | MSWRLFIGASILATGLLIKVGAPLVPVVMGIAMAAFFNWRRERRANFRR |
Ga0207697_103510371 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MNWRLFIGASILATGLLIKVGAPLIPVVMGIAMAAFFNWRRERRANSRR |
Ga0207650_111560422 | 3300025925 | Switchgrass Rhizosphere | MSWRLFIGASILATGLLIKAGAPLVPVVMGIAMAAFFNWRRERRANFRR |
Ga0207659_101410722 | 3300025926 | Miscanthus Rhizosphere | MSWKYFVGASILAAGLLIKVGAPLVPVALGIALAAFFNWRREHRAPAKR |
Ga0207687_106461731 | 3300025927 | Miscanthus Rhizosphere | MSWKLFVGASILSVGLLIKAGARLMPLVMGIAMAAFFNYRRQRGAAGKRRA |
Ga0207701_100169078 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MSWRLFIGASILATGLLIKVGAPLVPVVMGIAMAAVFNWRRERRANSRN |
Ga0207701_103648653 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MTWKFFVGASILATGLLIKVGAPLVPLAIGIAMAALVNWRRGLQRDRRHLP |
Ga0207686_103324452 | 3300025934 | Miscanthus Rhizosphere | MSWKLFVGASILSVGLLIKAGAPLMPLVMGIAMAAFFNYRRQRGAIGKHRADPPS |
Ga0207669_118025732 | 3300025937 | Miscanthus Rhizosphere | IRSYDVEMSWRLFIGASILATGLLIKVGAPLVPVVMGIAMAAFFNWRRERRANFRR |
Ga0207711_104771493 | 3300025941 | Switchgrass Rhizosphere | MSWKFFIGASILSAGLLIKVGAPLVPVVVGIAMAAFVNHWRQRGQPARR |
Ga0207711_115021802 | 3300025941 | Switchgrass Rhizosphere | MSWKLFVGASILSAGLLIKVGAPLVTVVMGIAMAAFFNHRRQRGATA |
Ga0207712_104116582 | 3300025961 | Switchgrass Rhizosphere | MSWKLFVGASILSVGLLIKAGAPLMPLVMGIAIAAFFNRWRQRGAIGKRRADPPS |
Ga0207658_109381621 | 3300025986 | Switchgrass Rhizosphere | SCKFFIGASILATGLLIKVGAPLVPVVMGVAMAAVFNWLRERRATVKR |
Ga0207675_1020827202 | 3300026118 | Switchgrass Rhizosphere | MSWRLFIGASILATGLLIKAGAPLVPVVMGIAMAAFFNWR |
Ga0208890_10868282 | 3300027523 | Soil | MNWKFFTGATILAVGLLIKIGAPLVPVAIGVAMAAMINWRRERRATVKR |
Ga0268265_107370622 | 3300028380 | Switchgrass Rhizosphere | MSWKLFVGASILSVGLLIKAGAPLMPLVMGIAIAAFFNHWRQRGAIGKRRADPPS |
Ga0247828_106600152 | 3300028587 | Soil | MSWKYFIGATILATGLLIKVGAPLVPLAIGIAMAALVNWRRGVQRDRRHLP |
(restricted) Ga0255311_10241422 | 3300031150 | Sandy Soil | MNWNLFVGASILVAGLLVKVGAPLPAVLLGIGLAALWNWKRPRGTSAGPSARR |
Ga0307499_101067382 | 3300031184 | Soil | MSWKFFTGASILAVGLLIKIGAPLVPIVIGVAMAAMVNWRRERRATVKR |
Ga0310888_103100542 | 3300031538 | Soil | MSWKYFVGASILATGLLIKIGAPLVPLALGVSMAAVFNWQLHRRS |
Ga0310887_104196821 | 3300031547 | Soil | ASILATGLLIKIGAPLVPLALGVSMAAVFNWQLHRRS |
Ga0307468_1011527802 | 3300031740 | Hardwood Forest Soil | MNWRLFIGASILATGLLIKVGAPLVPLAIGIAMAALVNWRRSLQRDRRQLP |
Ga0307468_1016962381 | 3300031740 | Hardwood Forest Soil | HDVDMSWKLFVGASILSVGLLIKAGAPLMPLVMGIAIAAFFNYRRQRGATGKRRAHRPS |
Ga0307468_1020054651 | 3300031740 | Hardwood Forest Soil | MNWRLFIGASILATGLLIKVGAPLVPLAIGIAMAALVNWRRSLQKDRRQLP |
Ga0310884_100143701 | 3300031944 | Soil | GDDVAMSWKYFVGASILATGLLIKIGAPLVPLALGVSMAAVFNWQLHRRS |
Ga0310902_100386151 | 3300032012 | Soil | KYFVGASILATGLLIKIGAPLVPLALGVSMAAVFNWQLHRRS |
Ga0310890_114199662 | 3300032075 | Soil | MSWKYFVGASILATGLLIKIGAPLVPLALGVSMAAVFNWQLH |
Ga0315912_107675032 | 3300032157 | Soil | MNWRLFIGASILATGLLVKIGAPLVPIVLGIAMAAFFNWRRDRRLTAKR |
Ga0364943_0061085_544_699 | 3300034354 | Sediment | MNWRLFIGASILATGLLIKVGAPPIPVAIGIAMAALVNWRRGLQRDRRQVP |
Ga0314788_030045_715_864 | 3300034666 | Soil | MSWKLFVGASILSAGLLIKVGAPLIPVAMGIAMAAFFNYRRQHGATAKR |
Ga0314792_030777_836_1003 | 3300034667 | Soil | MSWKYFVGASILAAGLLIKVGAPLVPVALGIAMAAFFNHWRQRGSLGKRRADPPS |
⦗Top⦘ |