NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105408

Metagenome / Metatranscriptome Family F105408

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105408
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 53 residues
Representative Sequence MTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYKGMSARRYRHT
Number of Associated Samples 92
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 76.00 %
% of genes near scaffold ends (potentially truncated) 32.00 %
% of genes from short scaffolds (< 2000 bps) 98.00 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.13

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(16.000 % of family members)
Environment Ontology (ENVO) Unclassified
(37.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(59.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.13
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF02467Whib 45.00
PF00570HRDC 26.00
PF13361UvrD_C 23.00
PF03109ABC1 1.00
PF13286HD_assoc 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0661Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB familySignal transduction mechanisms [T] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.00 %
UnclassifiedrootN/A4.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_101284241All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300002568|C688J35102_119799653All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300004006|Ga0055453_10046044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1178Open in IMG/M
3300004016|Ga0058689_10016012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1187Open in IMG/M
3300004114|Ga0062593_101117025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia820Open in IMG/M
3300004463|Ga0063356_101442079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1016Open in IMG/M
3300004463|Ga0063356_105708113All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300004480|Ga0062592_101760847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia604Open in IMG/M
3300005327|Ga0070658_10255703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1486Open in IMG/M
3300005337|Ga0070682_100184521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica1460Open in IMG/M
3300005338|Ga0068868_100105380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. HCCB100432286Open in IMG/M
3300005339|Ga0070660_100597541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia922Open in IMG/M
3300005347|Ga0070668_100915094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia785Open in IMG/M
3300005356|Ga0070674_100364651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1171Open in IMG/M
3300005436|Ga0070713_100731500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica946Open in IMG/M
3300005441|Ga0070700_100423546All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300005457|Ga0070662_100753732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia826Open in IMG/M
3300005530|Ga0070679_102109926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia513Open in IMG/M
3300005548|Ga0070665_102641669All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005614|Ga0068856_100644055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1080Open in IMG/M
3300005615|Ga0070702_100770558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica741Open in IMG/M
3300005617|Ga0068859_100299078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1703Open in IMG/M
3300005617|Ga0068859_100927865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia955Open in IMG/M
3300005718|Ga0068866_10208045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1173Open in IMG/M
3300005843|Ga0068860_100440888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1293Open in IMG/M
3300005844|Ga0068862_100174784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1924Open in IMG/M
3300005985|Ga0081539_10123708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1281Open in IMG/M
3300006028|Ga0070717_10841583All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300006237|Ga0097621_100447224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1164Open in IMG/M
3300006804|Ga0079221_10584177All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300006806|Ga0079220_10069783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1727Open in IMG/M
3300006806|Ga0079220_11449979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia585Open in IMG/M
3300009101|Ga0105247_11239529All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300009147|Ga0114129_11525663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia820Open in IMG/M
3300009148|Ga0105243_10533469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1118Open in IMG/M
3300009174|Ga0105241_11044177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia767Open in IMG/M
3300009176|Ga0105242_10279302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1516Open in IMG/M
3300009551|Ga0105238_10449455Not Available1285Open in IMG/M
3300010154|Ga0127503_10505862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae813Open in IMG/M
3300010371|Ga0134125_10480825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1376Open in IMG/M
3300010375|Ga0105239_10134784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2749Open in IMG/M
3300010397|Ga0134124_10616874All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300010399|Ga0134127_10281017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1593Open in IMG/M
3300010401|Ga0134121_10205917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1704Open in IMG/M
3300012212|Ga0150985_122192978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia980Open in IMG/M
3300012469|Ga0150984_115861764Not Available586Open in IMG/M
3300012469|Ga0150984_118168881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia977Open in IMG/M
3300012473|Ga0157340_1023601All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300012487|Ga0157321_1005493All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300012951|Ga0164300_10731236All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300012960|Ga0164301_11783930All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300012985|Ga0164308_10581081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia950Open in IMG/M
3300012986|Ga0164304_10407173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia968Open in IMG/M
3300014325|Ga0163163_10382773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1464Open in IMG/M
3300014969|Ga0157376_10993909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia861Open in IMG/M
3300015372|Ga0132256_100525772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1294Open in IMG/M
3300017965|Ga0190266_10185819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia977Open in IMG/M
3300018465|Ga0190269_11898335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia513Open in IMG/M
3300018466|Ga0190268_10422728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia868Open in IMG/M
3300018469|Ga0190270_10585358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1084Open in IMG/M
3300018476|Ga0190274_10275839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1545Open in IMG/M
3300019356|Ga0173481_10072332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1251Open in IMG/M
3300019767|Ga0190267_10303494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia829Open in IMG/M
3300020070|Ga0206356_10872460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia984Open in IMG/M
3300020082|Ga0206353_11116428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1195Open in IMG/M
3300021384|Ga0213876_10085574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1668Open in IMG/M
3300022915|Ga0247790_10051919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia945Open in IMG/M
3300025321|Ga0207656_10220227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia922Open in IMG/M
3300025899|Ga0207642_10089369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1518Open in IMG/M
3300025900|Ga0207710_10111960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1297Open in IMG/M
3300025900|Ga0207710_10327485Not Available777Open in IMG/M
3300025905|Ga0207685_10764315All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300025920|Ga0207649_10826147All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300025923|Ga0207681_10261771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1354Open in IMG/M
3300025927|Ga0207687_10486252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1028Open in IMG/M
3300025934|Ga0207686_11748011Not Available514Open in IMG/M
3300025936|Ga0207670_11196518All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300025945|Ga0207679_10267189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1461Open in IMG/M
3300025981|Ga0207640_10548918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia970Open in IMG/M
3300026023|Ga0207677_10616106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia954Open in IMG/M
3300027750|Ga0209461_10105325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia645Open in IMG/M
3300027765|Ga0209073_10040721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1488Open in IMG/M
3300027809|Ga0209574_10025189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1385Open in IMG/M
3300028587|Ga0247828_10064290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1635Open in IMG/M
3300028590|Ga0247823_10564034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia858Open in IMG/M
3300028707|Ga0307291_1031450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1242Open in IMG/M
3300028710|Ga0307322_10060884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia933Open in IMG/M
3300028715|Ga0307313_10149152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia722Open in IMG/M
3300028809|Ga0247824_10360974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia831Open in IMG/M
3300028809|Ga0247824_10537690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia694Open in IMG/M
3300028812|Ga0247825_10286951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1148Open in IMG/M
3300028812|Ga0247825_10463782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia899Open in IMG/M
3300028872|Ga0307314_10129643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia713Open in IMG/M
3300030336|Ga0247826_10745090All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300031058|Ga0308189_10434312All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300033550|Ga0247829_10626467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia895Open in IMG/M
3300033550|Ga0247829_10876520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia747Open in IMG/M
3300034666|Ga0314788_035480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae920Open in IMG/M
3300034667|Ga0314792_235800All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300034672|Ga0314797_025781All Organisms → cellular organisms → Bacteria957Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil12.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere5.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.00%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere2.00%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere2.00%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave2.00%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.00%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.00%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.00%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots1.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.00%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004006Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2EnvironmentalOpen in IMG/M
3300004016Agave microbial communities from Guanajuato, Mexico - As.Ma.rzHost-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012473Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610Host-AssociatedOpen in IMG/M
3300012487Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510Host-AssociatedOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027809Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028590Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034666Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034667Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034672Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10128424113300000956SoilISGGGAPMTNTTMRVITGTHVSGALPVLAQAPRAQKPRVAPFASWIDNYREMSARRYRHT
C688J35102_11979965323300002568SoilMTNTTMRAIPGTHVSGALPVVAPAPRAQKPRVAPFASWIDNYREMSARRYRHT*
Ga0055453_1004604433300004006Natural And Restored WetlandsMTTTTMRAFTGTHIAGAFLVDPTAPRAQKPRVAPFAPWSIDNSREVSAQRYRHT*
Ga0058689_1001601223300004016AgaveMTITTTRAFMGTHVSGALPVAPTAPRAQKPRVAPFAPWIDNYREMSARRYRHT*
Ga0062593_10111702513300004114SoilMTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFAPWIDNCKGMSARRYRHT*
Ga0063356_10144207923300004463Arabidopsis Thaliana RhizosphereMTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPFAPWIDNCKGMSARRYRHT*
Ga0063356_10570811313300004463Arabidopsis Thaliana RhizosphereMTNTTMRAITGTHVSGALPVLAQAPRAQKPRVAPFASWIDNYREMSARRYRHT*
Ga0062592_10176084713300004480SoilMTNTTMRVITGTHVSGALPVLAQAPRAQKPRVAPFASWIDNYREMSARRYRHT*
Ga0070658_1025570323300005327Corn RhizosphereVANTTMRAITGTHVSGVLPVATQAPRAQKPRVAPFASWIDNYREMSARRYRHT*
Ga0070682_10018452123300005337Corn RhizosphereMTTTTMRAYTGTRVSGALPVAWPTPLAQKPRVAPFAHQIVDNSKGTSARRYCHT*
Ga0068868_10010538013300005338Miscanthus RhizosphereMTNTTMRAFTGTHVSGALRVVTTAPSAQKPRVAPFAPWIDNYTGMSARRYRHT*
Ga0070660_10059754123300005339Corn RhizosphereVANTTMRAITGTHVSGVLPVAAQAPRAQKPRVAPFASWIDNYREMSARRYRHT*
Ga0070668_10091509423300005347Switchgrass RhizosphereMTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFAPWIDNCKGMSARR
Ga0070674_10036465113300005356Miscanthus RhizosphereMRAFTGTHVSGAPLVLTTAPSAQKPRVAPIAPWIDNCKGMSARRYRHT*
Ga0070713_10073150023300005436Corn, Switchgrass And Miscanthus RhizosphereMITTTTMRAITGTRVSGALLPAWTDPRAQKQRVAPFAHWTTDNSRGLSARGYRHT*
Ga0070700_10042354613300005441Corn, Switchgrass And Miscanthus RhizosphereMTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT*
Ga0070662_10075373223300005457Corn RhizosphereMTTTTMRPYTGTRVSGALPVAWPTPLAQKPRVAPFAHQIVDNSKGTSARRYCHT*
Ga0070679_10210992623300005530Corn RhizosphereMTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFAPWIDNYTGMSA
Ga0070665_10264166913300005548Switchgrass RhizospherePMTITTMRAITGTHVSGALLVDPTAPRAQKPRVAPSAPWFVDNSKEVSARRYRHT*
Ga0068856_10064405523300005614Corn RhizosphereMTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYKGMSARRYRHT*
Ga0070702_10077055823300005615Corn, Switchgrass And Miscanthus RhizosphereMTITTMRAITGTHVSGALLVDPTAPRAQKPRVAPSAPWFVDNSKEVSARRYRHT*
Ga0068859_10029907843300005617Switchgrass RhizosphereMTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYTGMSARRYRHT*
Ga0068859_10092786533300005617Switchgrass RhizosphereSGGGAPMTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT*
Ga0068866_1020804533300005718Miscanthus RhizosphereHIISGGGAPMTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT*
Ga0068860_10044088843300005843Switchgrass RhizosphereTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYKGMSARRYRHT*
Ga0068862_10017478413300005844Switchgrass RhizosphereHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT*
Ga0081539_1012370823300005985Tabebuia Heterophylla RhizosphereMTITTMREFTGTHVAGALVVVPTAPRAQKPRVAPFAPWPIDNSREMSARRYRHT*
Ga0070717_1084158323300006028Corn, Switchgrass And Miscanthus RhizosphereMTITTMRAITGTHASGALLVVPTAPRAQKQRVAPFAPWSTDNSREMSAPRYRHT*
Ga0097621_10044722423300006237Miscanthus RhizosphereMTNTTMRAITGTHVSGVLPVAAQAPRAQKPRVAPFASWIDNYREMSARRYRHT*
Ga0079221_1058417723300006804Agricultural SoilMTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRCRHT*
Ga0079220_1006978323300006806Agricultural SoilMTITTMRAITGTHVSGALFVVPTAPRAQKPRVSPFAPWSADNSREMSARRYRHT*
Ga0079220_1144997913300006806Agricultural SoilMTITTMRAITGTHVSGALPVVPTAPFAQKPRVAPFAPWSVDNCREKSALRYRHT*
Ga0105247_1123952923300009101Switchgrass RhizosphereMITTTTMRAITGTRVSGALPVAWPTPLAQKPRVAPFAHQIVDNSKGTSARRYCHT*
Ga0114129_1152566323300009147Populus RhizosphereMTNTTMRAFTGTHVSGALLVDPTAPRAQKPRVAPFASWPVDNYREKSARRYRHT*
Ga0105243_1053346913300009148Miscanthus RhizosphereGALLVVTTAPSAQKPRVAPFAPWIDNYTGMSAQRYRHT*
Ga0105241_1104417713300009174Corn RhizosphereMTTTTMRPYTGTRVSGALPVAWPTPLAQKPRVAPFAHQIGDNSKGTSARRYCHT*
Ga0105242_1027930223300009176Miscanthus RhizosphereMTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFAPWIDNCKGMS
Ga0105238_1044945513300009551Corn RhizosphereMTKTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFASWIDNYREMSARRYRHT
Ga0127503_1050586233300010154SoilMTITTMRAITGTHVAGALLVDQTAPRARKPRVAPFAPWSVDNSKEVSARRYRHT*
Ga0134125_1048082523300010371Terrestrial SoilMTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPFAPWIDNYTGMSARRYRHT*
Ga0105239_1013478443300010375Corn RhizosphereMTKTTMRAFTGTHVSGAPLVVTMAPSAQKPRVAPFAPWIDNCKGMSARRYRHT*
Ga0134124_1061687413300010397Terrestrial SoilITGTHVSGALPVVAQAPRAQKPRVAPFAPWIDNYREMSARRYRHT*
Ga0134127_1028101723300010399Terrestrial SoilMTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPIAPWIDNCKGMSARRYRHT*
Ga0134121_1020591723300010401Terrestrial SoilMTNTTMRAITGTHVSGALPVAAQAPRAQKPRVAPFASWIDNYREMSARRYRHT*
Ga0150985_12219297813300012212Avena Fatua RhizosphereGTHVSGALPVVAPAPRAQKPRVAPFASWIDNYREMSARRYRHT*
Ga0150984_11586176423300012469Avena Fatua RhizosphereMTITTMRATTGTHVSGALLVALTASRAQKPRVAPFAPWIDNYKGMSARRYRHT*
Ga0150984_11816888133300012469Avena Fatua RhizosphereMAITTMRAITGTHVSGALLVDPTAPRAQKPRVAPFARWSTDNSKEVSARRYRHT*
Ga0157340_102360123300012473Arabidopsis RhizosphereHIISGGGAPMTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFAPWPVDNYREKSARRYRHT*
Ga0157321_100549313300012487Arabidopsis RhizosphereMTSNTTMRAITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT*
Ga0164300_1073123613300012951SoilGGAPMTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT*
Ga0164301_1178393023300012960SoilMTITTMRAITGTHVSGALLVDPTAPRAQKPRVAPFAPWIDNYTGMSARRYRHT*
Ga0164308_1058108123300012985SoilMTITTMRAITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT*
Ga0164304_1040717323300012986SoilMITNTTMRAITGTHVSGALLVDPTAPRAQKPRVAPFAHWTTDNSRGLSARGYRHT*
Ga0163163_1038277323300014325Switchgrass RhizosphereMTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWSVDNCREKSALRYRHT*
Ga0157376_1099390913300014969Miscanthus RhizosphereMTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFAPWIDNYKGMSARRYRHT*
Ga0132256_10052577223300015372Arabidopsis RhizosphereMTSNTTMRAITGTRVSGAPLGVWTDPRAQKLRVPPFAHMTTDNSKRTSARRYRQT*
Ga0190266_1018581913300017965SoilMTITTMRAITGTHVSGALLVDPTAPRAQKPRVAPFAPWSIDNSREMSARRYRH
Ga0190269_1189833523300018465SoilMTITTMRACTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYRGMSARRYRHT
Ga0190268_1042272823300018466SoilMTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPFVPWIDNYRGMSARRYRHT
Ga0190270_1058535823300018469SoilMTITTMRAITGTHVSGALLVDPTAPRAQKPRVAPFAPWSIDNSREMSARRYRHT
Ga0190274_1027583923300018476SoilMTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPIAPWIDNCKGMSARRYRHT
Ga0173481_1007233223300019356SoilMTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFAPWIDNCKGMSARRYRHT
Ga0190267_1030349413300019767SoilMTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPIAPWIDNCKGMSARRYRHT
Ga0206356_1087246013300020070Corn, Switchgrass And Miscanthus RhizospherePMTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYTGMSARRYRHT
Ga0206353_1111642833300020082Corn, Switchgrass And Miscanthus RhizosphereHVRHIISGGGAPMTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT
Ga0213876_1008557433300021384Plant RootsMTTTTMRVYTGTRVSGALPVAWPTPRAQKTRVAPFAQQIVDNSKGTSARRYRHT
Ga0247790_1005191913300022915SoilMTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFAPWIDNCKGMSARRYR
Ga0207656_1022022723300025321Corn RhizosphereMTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFAPWIDNCKGMSARRYRHT
Ga0207642_1008936913300025899Miscanthus RhizosphereVRHIISGGGAPMTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT
Ga0207710_1011196023300025900Switchgrass RhizosphereMTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYKEMSARRYRHT
Ga0207710_1032748513300025900Switchgrass RhizospherePYTGTRVSGALPVAWPTPLAQKPRVAPFAHQIVDNSKGTSARRYCHT
Ga0207685_1076431523300025905Corn, Switchgrass And Miscanthus RhizosphereMTITTMREFTGTHVSGALLVVPTALRAQKPRVAPFAPWSIDNYREMSARRYRHT
Ga0207649_1082614723300025920Corn RhizosphereMTNTTMRAFTGTHVSGALRVVTTAPSAQKPRVAPFAPWIDNCKGMSARRYRHT
Ga0207681_1026177133300025923Switchgrass RhizosphereMTKTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFAPWIDNCKGMSARRYRHT
Ga0207687_1048625223300025927Miscanthus RhizosphereMTTTTMRPYTGTRVSGALPVAWPTPLAQKPRVAPFAHQIVDNSKGTSARRYCHT
Ga0207686_1174801113300025934Miscanthus RhizosphereMTNTTMRAITGTHVSGVLPVAAQAPRAQKPRVAPFASWIDNYREMSARRYRHT
Ga0207670_1119651823300025936Switchgrass RhizosphereLPVAAQAPRAQKPRVAPFASWIDNYREMSARRYRHT
Ga0207679_1026718913300025945Corn RhizosphereMTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNCKGMSARRYRHT
Ga0207640_1054891823300025981Corn RhizosphereMTNTTMRAITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT
Ga0207677_1061610623300026023Miscanthus RhizosphereMTNTTMRAFTGTHVSGALRVVTTAPSAQKPRVAPFAPWIDNYTGMSARRYRHT
Ga0209461_1010532523300027750AgaveMTITTMRACTGTHVSGALLVVTTAPRAQKPRVAPFAPWIDNYREMSARRYRHT
Ga0209073_1004072123300027765Agricultural SoilMTITTMRAITGTHVSGALFVVPTAPRAQKPRVSPFAPWSADNSREMSARRYRHT
Ga0209574_1002518923300027809AgaveMTITTMRACTGTHVSGALLVVTTAPRAQKPRVAPFAPWIDNYRGMSARRYRHT
Ga0247828_1006429023300028587SoilMTNTTMRAITGTHVSGALPVLAQAPRAQKPRVAPFASWIDNYREMSARRYRHT
Ga0247823_1056403423300028590SoilMTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYKGMSARRYRHT
Ga0307291_103145023300028707SoilMTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPFAPWIDNCKGMSARRYRHT
Ga0307322_1006088423300028710SoilMTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPIAPWIDNCKGMSA
Ga0307313_1014915223300028715SoilMTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPFAPWIDNCKGMSARRY
Ga0247824_1036097423300028809SoilMTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPSAPWIDNCKGMSARRYRHT
Ga0247824_1053769023300028809SoilMTNTTMRAFTGTHVSGALRVVTTAPSAQKPRVAPFAPWIDNYTGMSAQRYRHT
Ga0247825_1028695123300028812SoilMTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYTGMSARRYRHT
Ga0247825_1046378223300028812SoilMTNTTMRAITGTHVSGALLVDPTAPRAQKPRVAPFAPWSIDNSKEMSARRYRHT
Ga0307314_1012964313300028872SoilMTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPFAPWIDNCKGMSARRYRH
Ga0247826_1074509023300030336SoilVTITTMREITGTHVSGALLVVPTAPRAQKPRVAPFAPWSTDNYREMSARRYRHT
Ga0308189_1043431223300031058SoilHNVWRGGAPMTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPIAPWIDNCKGMSARRYRHT
Ga0247829_1062646713300033550SoilFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYKGMSARRYRHT
Ga0247829_1087652023300033550SoilMTNTTMRAITGTHVSGALLVDPTAPRAQKPRVAPSAPWFVDNSKEVSARRYRHT
Ga0314788_035480_1_1983300034666SoilHVRHNVWRGGAPMTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYTGMSARRYRHT
Ga0314792_235800_3_1913300034667SoilHIAPRRCPVTITMMREFTGTHVSGALLVVPTSPRAQKPRVAPFAPWPVDNYREKSARRYRHT
Ga0314797_025781_765_9563300034672SoilRHIISGGGAPMTNTTMRAITGTHVSGALPVLAQAPRAQKPRVAPFASWIDNYREMSARRYRHT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.