NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105243

Metagenome / Metatranscriptome Family F105243

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105243
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 86 residues
Representative Sequence MKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPDVNEAWE
Number of Associated Samples 84
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 72.00 %
% of genes near scaffold ends (potentially truncated) 42.00 %
% of genes from short scaffolds (< 2000 bps) 75.00 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (56.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(18.000 % of family members)
Environment Ontology (ENVO) Unclassified
(68.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.47%    β-sheet: 11.76%    Coil/Unstructured: 71.76%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF11351GTA_holin_3TM 3.00
PF00182Glyco_hydro_19 1.00
PF13481AAA_25 1.00
PF00145DNA_methylase 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 1.00
COG3179Chitinase, GH19 familyCarbohydrate transport and metabolism [G] 1.00
COG3979ChitodextrinaseCarbohydrate transport and metabolism [G] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.00 %
UnclassifiedrootN/A22.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10008381All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium6893Open in IMG/M
3300000101|DelMOSum2010_c10144018All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium888Open in IMG/M
3300000101|DelMOSum2010_c10155988All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium829Open in IMG/M
3300000101|DelMOSum2010_c10253471Not Available552Open in IMG/M
3300000116|DelMOSpr2010_c10181911Not Available689Open in IMG/M
3300000928|OpTDRAFT_10048135Not Available5608Open in IMG/M
3300001349|JGI20160J14292_10011291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5706Open in IMG/M
3300001352|JGI20157J14317_10020309All Organisms → Viruses → Predicted Viral3829Open in IMG/M
3300001352|JGI20157J14317_10184680All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium610Open in IMG/M
3300004448|Ga0065861_1018527Not Available562Open in IMG/M
3300004460|Ga0066222_1054378All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium561Open in IMG/M
3300004461|Ga0066223_1027562Not Available936Open in IMG/M
3300006029|Ga0075466_1024091All Organisms → Viruses → Predicted Viral1945Open in IMG/M
3300006029|Ga0075466_1140947All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium626Open in IMG/M
3300006399|Ga0075495_1198121Not Available9324Open in IMG/M
3300006484|Ga0070744_10000770Not Available9477Open in IMG/M
3300006752|Ga0098048_1036086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA48121594Open in IMG/M
3300006752|Ga0098048_1222063All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium555Open in IMG/M
3300006793|Ga0098055_1072602All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium1360Open in IMG/M
3300006810|Ga0070754_10076246All Organisms → cellular organisms → Bacteria → Proteobacteria1701Open in IMG/M
3300006920|Ga0070748_1223712All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium682Open in IMG/M
3300006924|Ga0098051_1037976All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium1352Open in IMG/M
3300007229|Ga0075468_10003887All Organisms → cellular organisms → Bacteria6290Open in IMG/M
3300007229|Ga0075468_10168776All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium653Open in IMG/M
3300007345|Ga0070752_1115406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA48121135Open in IMG/M
3300007539|Ga0099849_1026115All Organisms → Viruses → Predicted Viral2519Open in IMG/M
3300007540|Ga0099847_1085990All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium966Open in IMG/M
3300007640|Ga0070751_1244268Not Available684Open in IMG/M
3300009436|Ga0115008_10671005All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium751Open in IMG/M
3300009442|Ga0115563_1079563All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium1454Open in IMG/M
3300009467|Ga0115565_10372076All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium647Open in IMG/M
3300009505|Ga0115564_10238527Not Available931Open in IMG/M
3300009505|Ga0115564_10277095All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium846Open in IMG/M
3300009507|Ga0115572_10383681All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium788Open in IMG/M
3300009599|Ga0115103_1725519Not Available1219Open in IMG/M
3300009606|Ga0115102_10203994All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium643Open in IMG/M
3300010150|Ga0098056_1054858Not Available1376Open in IMG/M
3300010430|Ga0118733_100270523All Organisms → Viruses → Predicted Viral3360Open in IMG/M
3300010883|Ga0133547_11211507All Organisms → Viruses → Predicted Viral1441Open in IMG/M
3300011118|Ga0114922_10055193All Organisms → Viruses → Predicted Viral3462Open in IMG/M
3300011128|Ga0151669_133391All Organisms → Viruses → Predicted Viral1215Open in IMG/M
3300011253|Ga0151671_1023019All Organisms → Viruses → Predicted Viral2782Open in IMG/M
3300011258|Ga0151677_1016719All Organisms → Viruses → Predicted Viral3981Open in IMG/M
3300013010|Ga0129327_10138190All Organisms → Viruses → Predicted Viral1210Open in IMG/M
3300013010|Ga0129327_10298233All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium834Open in IMG/M
3300017697|Ga0180120_10065871All Organisms → Viruses → Predicted Viral1612Open in IMG/M
3300017697|Ga0180120_10314676All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium624Open in IMG/M
3300017713|Ga0181391_1053738Not Available946Open in IMG/M
3300017719|Ga0181390_1159156All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium563Open in IMG/M
3300017735|Ga0181431_1012007All Organisms → cellular organisms → Bacteria → Proteobacteria2064Open in IMG/M
3300017741|Ga0181421_1127978All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium658Open in IMG/M
3300017752|Ga0181400_1160706All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium634Open in IMG/M
3300017756|Ga0181382_1083294Not Available881Open in IMG/M
3300017769|Ga0187221_1218418All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium545Open in IMG/M
3300017782|Ga0181380_1045930All Organisms → Viruses → Predicted Viral1574Open in IMG/M
3300020165|Ga0206125_10012456Not Available5794Open in IMG/M
3300020165|Ga0206125_10125296All Organisms → Viruses → Predicted Viral1057Open in IMG/M
3300020165|Ga0206125_10141643All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium974Open in IMG/M
3300020166|Ga0206128_1021590All Organisms → Viruses → Predicted Viral3642Open in IMG/M
3300020175|Ga0206124_10344535All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium562Open in IMG/M
3300020182|Ga0206129_10226881Not Available803Open in IMG/M
3300020185|Ga0206131_10038021All Organisms → cellular organisms → Bacteria → Proteobacteria3460Open in IMG/M
3300020438|Ga0211576_10363031All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium745Open in IMG/M
3300021347|Ga0213862_10065122All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium1292Open in IMG/M
3300021371|Ga0213863_10001783All Organisms → cellular organisms → Bacteria15512Open in IMG/M
3300021957|Ga0222717_10213612All Organisms → Viruses → Predicted Viral1138Open in IMG/M
3300021959|Ga0222716_10422850All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium768Open in IMG/M
3300022072|Ga0196889_1001101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria7522Open in IMG/M
3300022164|Ga0212022_1000224All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium5084Open in IMG/M
3300022164|Ga0212022_1000986All Organisms → Viruses → Predicted Viral2851Open in IMG/M
3300022169|Ga0196903_1016632Not Available895Open in IMG/M
3300022178|Ga0196887_1001871Not Available8865Open in IMG/M
3300022178|Ga0196887_1054353All Organisms → Viruses → Predicted Viral1010Open in IMG/M
3300022201|Ga0224503_10309452All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium525Open in IMG/M
3300022220|Ga0224513_10019346All Organisms → cellular organisms → Bacteria → Proteobacteria2484Open in IMG/M
3300022308|Ga0224504_10476353All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium521Open in IMG/M
(restricted) 3300023109|Ga0233432_10098146All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium1656Open in IMG/M
3300023567|Ga0228694_101709All Organisms → cellular organisms → Bacteria → Proteobacteria2193Open in IMG/M
3300023568|Ga0228696_1005234All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium1493Open in IMG/M
3300023674|Ga0228697_111251All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium843Open in IMG/M
3300023693|Ga0232112_1005046All Organisms → Viruses → Predicted Viral1434Open in IMG/M
(restricted) 3300024062|Ga0255039_10302796Not Available682Open in IMG/M
3300024183|Ga0228603_1045340All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium665Open in IMG/M
3300024191|Ga0228636_1060820Not Available888Open in IMG/M
(restricted) 3300024264|Ga0233444_10139808All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium1191Open in IMG/M
(restricted) 3300024264|Ga0233444_10253091All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium782Open in IMG/M
3300024281|Ga0228610_1026028Not Available731Open in IMG/M
3300024420|Ga0228632_1021214All Organisms → Viruses → Predicted Viral1495Open in IMG/M
3300024508|Ga0228663_1035156All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium967Open in IMG/M
3300025070|Ga0208667_1014367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA48121695Open in IMG/M
3300025070|Ga0208667_1021745All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium1238Open in IMG/M
3300025832|Ga0209307_1050029All Organisms → Viruses → Predicted Viral1514Open in IMG/M
3300025853|Ga0208645_1185492Not Available752Open in IMG/M
3300026434|Ga0247591_1001654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA48122648Open in IMG/M
3300026511|Ga0233395_1037536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCA48121510Open in IMG/M
(restricted) 3300027861|Ga0233415_10237897All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium848Open in IMG/M
3300028416|Ga0228614_1023580All Organisms → Viruses → Predicted Viral1527Open in IMG/M
3300031519|Ga0307488_10193677All Organisms → Viruses → Predicted Viral1383Open in IMG/M
3300031766|Ga0315322_10000821All Organisms → cellular organisms → Bacteria23641Open in IMG/M
3300032373|Ga0316204_11273475Not Available511Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous18.00%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater14.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine9.00%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater9.00%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater7.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine6.00%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine5.00%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater4.00%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient4.00%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine3.00%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine3.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine3.00%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment3.00%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.00%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.00%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment1.00%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.00%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.00%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.00%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.00%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300001349Pelagic Microbial community sample from North Sea - COGITO 998_met_10EnvironmentalOpen in IMG/M
3300001352Pelagic Microbial community sample from North Sea - COGITO 998_met_07EnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300011128Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02EnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022201Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022220Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21EnvironmentalOpen in IMG/M
3300022308Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24EnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023567Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 80R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023568Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 84R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023674Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 90R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023693Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 29R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024183Seawater microbial communities from Monterey Bay, California, United States - 3DEnvironmentalOpen in IMG/M
3300024191Seawater microbial communities from Monterey Bay, California, United States - 45DEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024281Seawater microbial communities from Monterey Bay, California, United States - 11DEnvironmentalOpen in IMG/M
3300024420Seawater microbial communities from Monterey Bay, California, United States - 40DEnvironmentalOpen in IMG/M
3300024508Seawater microbial communities from Monterey Bay, California, United States - 77DEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025832Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026434Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026511Seawater microbial communities from Monterey Bay, California, United States - 27DEnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300028416Seawater microbial communities from Monterey Bay, California, United States - 15DEnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1000838163300000101MarineMKKVKVNSIKLNCSNGRIEKGEVTTLPDDEVAKIIKLRPHVITILDSVEEKPKKVVKKSILKRARNSNGTLKADDPSTPDINEAWEKK*
DelMOSum2010_1014401813300000101MarineMKKVLVNAIKLHCSVGRIEKGETVILPDEEIAKINKLRPHIITVIEDVVEKPAKKPLLKRKRARNDNGTLKSDDPSTPDVNEAWE*
DelMOSum2010_1015598823300000101MarineMKKVLVNAIKLHCSVGRIEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNANGTLKSDDPSTPNVNEAWKE*
DelMOSum2010_1025347123300000101MarineLPLLTSLETKMKKVLVNAIKLHXSKGRVEKGETVILPDEEIAKINKLRPXIITVMEDVVEKPAKKPLLKRKRARNDNGTLKSDDKSTPDVNEAWE*
DelMOSpr2010_1018191123300000116MarineLPLLTSLENKMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKLRPHVITVIEDVVEKPAKKAPAKRKRARNDNGTLKSDDKSTRDVNEAWK*
OpTDRAFT_10048135133300000928Freshwater And MarineMKKVLVNAIKLHCSVGRIEKGETAILPDEEIAKINKLRPHIITVIEDVVEKPAKKAPAKRKRARNDNGTLKSDDPSTPDVNEAWEDK*
JGI20160J14292_1001129163300001349Pelagic MarineMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKAPAKRKRARNANGTLKSDDPSTPDVNEAWE*
JGI20157J14317_1002030913300001352Pelagic MarineHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEDK*
JGI20157J14317_1018468013300001352Pelagic MarineSVKLGAASVAPFTSLETKMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNANGTLKSDDPSTPDVNEAWE*
Ga0065861_101852723300004448MarineLPLLTSLENIMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKLRPHIITVIEDVVEKPAKKAPAKRKRARNDNGTLKSDDKSTPDVN
Ga0066222_105437823300004460MarineLPLLTSLETKMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPDVNEAWEN*
Ga0066223_102756213300004461MarineMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNDNGTLKSDDKSTPDVNE
Ga0075466_102409123300006029AqueousMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPDVNEAWE*
Ga0075466_114094723300006029AqueousMKKVKVNSIKLNCSKGRIEKGEITTLPDDEVAKIVKLRPHVITILDSVEEKPKKVAKKSILKRARNSNGTLKADDPSTPNINEAWEKK*
Ga0075495_1198121213300006399AqueousMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKLRPHVITVIEDVVEKPAKKAPAKRKRARNENGTLKSDDPSTPDVNEAWE*
Ga0070744_1000077053300006484EstuarineMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEDK*
Ga0098048_103608633300006752MarineMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKMRPHVITVIEDVVEKPAKKAPAKRKRARNTNGTLKSDDPSTPNVNEAWEE*
Ga0098048_122206323300006752MarineNIMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKLRPHVITVVEDVVEKPAKKAPAKRKRARNTNGTLKSDDPSTPDINEAWEE*
Ga0098055_107260213300006793MarineMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKLRPHVITVIEDVVEKPAKKAPAKRKRARNTNGTLKSDDPSTPNVNEAWEE*
Ga0070754_1007624623300006810AqueousMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNANGTLKSDDPSTPNVNEAWKE*
Ga0070748_122371213300006920AqueousVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPDVNEAWE*
Ga0098051_103797613300006924MarineMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKLRPHVITVVEDVVEKPAKKAPAKRKRARNTNGTLKSDDPSTPDINEAWE
Ga0075468_1000388713300007229AqueousKMKKVKVNSIKLNCSNGRIEKGEVTTLPDDEVAKIIKLRPHVITILDSVEEKPKKVVKKSILKRARNSNGTLKADDPSTPDINEAWEKK*
Ga0075468_1016877613300007229AqueousLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPDVNEAWE*
Ga0070752_111540623300007345AqueousMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNANGTLKSDDPST
Ga0099849_102611523300007539AqueousMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNANGTLKSDDPSTPNVNEAWEE*
Ga0099847_108599013300007540AqueousVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNANGTLKSDDPSTPNVNEAWKE*
Ga0070751_124426823300007640AqueousMKKVLVKAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPDVNEAW
Ga0115008_1067100523300009436MarineMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITIMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEDK*
Ga0115563_107956333300009442Pelagic MarineMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNANGTLKSDDPSTPDVNEAWE*
Ga0115565_1037207633300009467Pelagic MarineVAPFTSLETKMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEDK*
Ga0115564_1023852733300009505Pelagic MarineMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNDNGTLKSDDKSTPNINEAWEN*
Ga0115564_1027709513300009505Pelagic MarineNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEDK*
Ga0115572_1038368113300009507Pelagic MarineRVEKGETVILPVEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEDK*
Ga0115103_172551933300009599MarineMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEE*
Ga0115102_1020399413300009606MarineHNFISSVKLGAASVAPFTSLETKMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKVRPHVITVMKDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEE*
Ga0098056_105485823300010150MarineMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKMRPHVITVIEDVVEKPAKKAPAKRKRARNTNGTLKSDDPSTPNVNEAWEK*
Ga0118733_10027052333300010430Marine SedimentMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKTAKKPLLKRKRARNANGTLKSDDPSTPDVNEAWE*
Ga0133547_1121150723300010883MarineMKKVLVNAIKLHCSKGRIEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNDNGTLKSDDPSTPDVNEAWE*
Ga0114922_1005519383300011118Deep SubsurfaceKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNDNGTLKSDDKSTPNINEAWE*
Ga0151669_13339143300011128MarineMKKVLVNAIKLHCSKGRIEKGETVILPDEEIDKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNANGTLKSDDPSTPDVNEAWE*
Ga0151671_102301913300011253MarineLRLPLLTSLETKMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNVNEAWEE*
Ga0151677_101671983300011258MarineMKKVLVNAIKLHCSKGRIEKGETVILPDEEVDKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNVNEAWEE*
Ga0129327_1013819043300013010Freshwater To Marine Saline GradientKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPDVNEAWE*
Ga0129327_1029823333300013010Freshwater To Marine Saline GradientLRLPLLTSLETKMKKVLVNAIKLHCSKGRIEKGETVILPDEEVDKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNVNEAWEE*
Ga0180120_1006587153300017697Freshwater To Marine Saline GradientQLRLPLLTSLETKMKKVLVNAIKLHCSKGRIEKGETVILPDEEVDKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNVNEAWEE
Ga0180120_1031467633300017697Freshwater To Marine Saline GradientVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPDVNEAWE
Ga0181391_105373823300017713SeawaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLK
Ga0181390_115915613300017719SeawaterTKMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEDK
Ga0181431_101200733300017735SeawaterMKKVLVNAIKLHCSKGRIEKGETVVLPDEEVAKINKLRPHVITVIEDVVEKPAKKPLLKRKRARNANGTLKSDDPSTPNINEAWEK
Ga0181421_112797823300017741SeawaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHVITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEE
Ga0181400_116070613300017752SeawaterFTSLETKMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEDK
Ga0181382_108329423300017756SeawaterMKKVLVNAIKLHCSKGRIEKGETVILPDEEIAKINKVRPHVITVMEDVVEKPAKKPLLKRKRARNANGTLKSDDPSTPNINEAWEE
Ga0187221_121841823300017769SeawaterMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKLRPHVITVIEDVVEKPAKKAPAKRKRARNANGTLKSDDPSTPDVNEAWEE
Ga0181380_104593013300017782SeawaterLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPNIITVMEDVVEKPAKKPLLKRKRARNDNGTLKSDDPSTPDVNEAWEDK
Ga0206125_10012456133300020165SeawaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKAPAKRKRARNANGTLKSDDPSTPDVNEAWE
Ga0206125_1012529633300020165SeawaterMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKLRPHVITVIEDVVEKPAKKAPAKRKRARNANGTLKSDDPSTPDVNEAWEN
Ga0206125_1014164313300020165SeawaterKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNDNGTLKSDDKSTPNINEAWEN
Ga0206128_102159093300020166SeawaterMKKIIVNGIKLHCSKGRIEKGETVTLPDEEIAKINKMRPHLITVVEDVVEKPAKAAKKRKRARNDNGTLKSDDPSTPNVNEAWE
Ga0206124_1034453513300020175SeawaterKRLVNGIKLHCSKGRIEKGETVTLPDEEIAKINKMRPHLITVVEDVVEKPAKAAKKRKRARNDNGTLKSDDPSTPNVNEAWE
Ga0206129_1022688123300020182SeawaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNDNGTLKSDDKSTPNINEAWEN
Ga0206131_1003802143300020185SeawaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNANGTLKSDDPSTPDVNEAWE
Ga0211576_1036303123300020438MarineMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEDK
Ga0213862_1006512213300021347SeawaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNANGTLKSDDPSTPNVNEAWEE
Ga0213863_10001783263300021371SeawaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNANGTLKSDDPSTPNVNEAWKE
Ga0222717_1021361243300021957Estuarine WaterMKKVLVNAIKLHCSKGRIEKGETVVLPDEEVAKINKLRPHVITVIEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEE
Ga0222716_1042285033300021959Estuarine WaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIDKINKLRPHIITVMEDVVEKPAKKSLLKRKRARNDNGTLKSDDPSTPDVNEAWE
Ga0196889_100110163300022072AqueousMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPDVNEAWE
Ga0212022_100022473300022164AqueousMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKLRPHVITVIEDVVEKPAKKAPAKRKRARNENGTLKSDDPSTPDVNEAWE
Ga0212022_100098623300022164AqueousMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKTAKKPLLKRKRARNANGTLKSDDPSTPDVNEAWE
Ga0196903_101663223300022169AqueousMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNDNGTLKSDDKSTPDVN
Ga0196887_1001871103300022178AqueousMKKVKVNSIKLNCSKGRIEKGEITTLPDDEVAKIVKLRPHVITILDSVEEKPKKVAKKSILKRARNSNGTLKADDPSTPNINEAWEKK
Ga0196887_105435333300022178AqueousMKKVKVNSIKLNCSNGRIEKGEVTTLPDDEVAKIIKLRPHVITILDSVEEKPKKVVKKSILKRARNSNGTLKADDPSTPDINEAWEKK
Ga0224503_1030945213300022201SedimentLENIMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKLRPHVITVIEDVVEKPAKKAPAKRKRARNENGTLKSDDPSTPNINEAWEE
Ga0224513_1001934633300022220SedimentMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKLRPHVITVIEDVVEKPAKKPLLKRKRARNDNGTLKSDDPSTPDVNEAWEDK
Ga0224504_1047635323300022308SedimentMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEE
(restricted) Ga0233432_1009814633300023109SeawaterMKKVLVNAIKLHCSVGRVEKGETVILPDEEIAKINKLRPHVITVMEDVVEKPAKKPLLKRKRARNDNGTLKSDDPSTPDVNEAWE
Ga0228694_10170933300023567SeawaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNANGTLKSDDPSTPNINEAWEE
Ga0228696_100523433300023568SeawaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEK
Ga0228697_11125113300023674SeawaterMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKLRPHVITVVEDVVEKPAKKAPAKRKRARNTNGTLKSDDPSTPDINEAWEE
Ga0232112_100504633300023693SeawaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEGVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEDK
(restricted) Ga0255039_1030279623300024062SeawaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNDNGTLKSDDPSTPDVNEA
Ga0228603_104534033300024183SeawaterMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKLRPHVITVVEDVVEKPAKKAPAKRKRARNTNGTLKSDYPSTPDINEAWEE
Ga0228636_106082013300024191SeawaterMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKLRPHVITVVEDVVEKPAKKAPAKRKRARNTNGTLKSDDP
(restricted) Ga0233444_1013980823300024264SeawaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNDNGTLKSDDPSTPDVNEAWE
(restricted) Ga0233444_1025309133300024264SeawaterPFTSLETKMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEDK
Ga0228610_102602823300024281SeawaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEALEDK
Ga0228632_102121423300024420SeawaterMKKVLVNAIKLNCSVGRIEKGETAILPDEEVAKINKLRPHVITVVEDVVEKPAKKAPAKRKRARNTNGTLKSDDPSTPYINEAWEE
Ga0228663_103515643300024508SeawaterSLETKIKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEDK
Ga0208667_101436723300025070MarineMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKMRPHVITVIEDVVEKPAKKAPAKRKRARNTNGTLKSDDPSTPNVNEAWEE
Ga0208667_102174523300025070MarineMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKLRPHVITVIEDVVEKPAKKAPAKRKRARNTNGTLKSDDPSTPNVNEAWEE
Ga0209307_105002913300025832Pelagic MarineKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEDK
Ga0208645_118549213300025853AqueousMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNANGTLKSDDPSTPNV
Ga0247591_100165413300026434SeawaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSD
Ga0233395_103753613300026511SeawaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDP
(restricted) Ga0233415_1023789713300027861SeawaterLRLPLLTSLETKMKKVLVNAIKLHCSVGRIEKGETAILPDEEVAKINKLRPHVITVIEDVVEKPAKKAPAKRKRARNENGTLKSDDPSTPDVNEAWE
Ga0228614_102358053300028416SeawaterMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEGVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPNINEAWEE
Ga0307488_1019367743300031519Sackhole BrineMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNTNGTLKSDDPSTPDVNEAWEN
Ga0315322_1000082153300031766SeawaterMKKVKVNSIKLNCSNGRIEKGEVTTLPDDEVAKIIKLRPHVITILDSVEEKPKKVAKKSILKRARNSNGTLKADDPSTPDINEAWEKK
Ga0316204_1127347523300032373Microbial MatMKKVLVNAIKLHCSKGRVEKGETVILPDEEIAKINKLRPHIITVMEDVVEKPAKKPLLKRKRARNDNGTLKSDDKST

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.