NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F105219

Metatranscriptome Family F105219

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105219
Family Type Metatranscriptome
Number of Sequences 100
Average Sequence Length 91 residues
Representative Sequence PWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKFIPNCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Number of Associated Samples 55
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.02 %
% of genes near scaffold ends (potentially truncated) 97.00 %
% of genes from short scaffolds (< 2000 bps) 99.00 %
Associated GOLD sequencing projects 51
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (89.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(79.000 % of family members)
Environment Ontology (ENVO) Unclassified
(90.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 27.12%    β-sheet: 0.85%    Coil/Unstructured: 72.03%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.00 %
UnclassifiedrootN/A11.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006415|Ga0099654_10130257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300008832|Ga0103951_10131883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1124Open in IMG/M
3300008832|Ga0103951_10438635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata700Open in IMG/M
3300008832|Ga0103951_10699177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300008832|Ga0103951_10701758All Organisms → cellular organisms → Eukaryota → Sar552Open in IMG/M
3300008832|Ga0103951_10752874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300008832|Ga0103951_10819758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata506Open in IMG/M
3300008834|Ga0103882_10081758Not Available537Open in IMG/M
3300009022|Ga0103706_10073429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata749Open in IMG/M
3300009025|Ga0103707_10082865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata649Open in IMG/M
3300009216|Ga0103842_1047859All Organisms → cellular organisms → Eukaryota → Sar526Open in IMG/M
3300009216|Ga0103842_1054455Not Available505Open in IMG/M
3300009274|Ga0103878_1033500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata580Open in IMG/M
3300009276|Ga0103879_10032484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata583Open in IMG/M
3300009276|Ga0103879_10039431Not Available558Open in IMG/M
3300009276|Ga0103879_10041007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300009276|Ga0103879_10047201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata534Open in IMG/M
3300009276|Ga0103879_10048394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300018555|Ga0193296_105357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata510Open in IMG/M
3300018608|Ga0193415_1022238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300018616|Ga0193064_1022894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata576Open in IMG/M
3300018616|Ga0193064_1028828Not Available515Open in IMG/M
3300018628|Ga0193355_1032095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata503Open in IMG/M
3300018637|Ga0192914_1015219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata592Open in IMG/M
3300018648|Ga0193445_1036368Not Available636Open in IMG/M
3300018648|Ga0193445_1037647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata624Open in IMG/M
3300018648|Ga0193445_1041862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata587Open in IMG/M
3300018649|Ga0192969_1052912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300018720|Ga0192866_1072172All Organisms → cellular organisms → Eukaryota → Sar517Open in IMG/M
3300018720|Ga0192866_1072175All Organisms → cellular organisms → Eukaryota → Sar517Open in IMG/M
3300018720|Ga0192866_1075318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata502Open in IMG/M
3300018739|Ga0192974_1072123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300018741|Ga0193534_1071045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata508Open in IMG/M
3300018758|Ga0193058_1070176All Organisms → cellular organisms → Eukaryota → Sar556Open in IMG/M
3300018794|Ga0193357_1086175All Organisms → cellular organisms → Eukaryota → Sar513Open in IMG/M
3300018807|Ga0193441_1093253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300018850|Ga0193273_1060596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata569Open in IMG/M
3300018850|Ga0193273_1065402All Organisms → cellular organisms → Eukaryota → Sar551Open in IMG/M
3300018854|Ga0193214_1106191Not Available503Open in IMG/M
3300018883|Ga0193276_1102319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata582Open in IMG/M
3300018903|Ga0193244_1074202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata629Open in IMG/M
3300018903|Ga0193244_1090496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata565Open in IMG/M
3300018903|Ga0193244_1092172All Organisms → cellular organisms → Eukaryota → Sar559Open in IMG/M
3300018903|Ga0193244_1098394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata539Open in IMG/M
3300018903|Ga0193244_1100754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300018903|Ga0193244_1101740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata529Open in IMG/M
3300018927|Ga0193083_10064199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata555Open in IMG/M
3300018929|Ga0192921_10235803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300018929|Ga0192921_10235842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300018951|Ga0193128_10131888Not Available604Open in IMG/M
3300018951|Ga0193128_10180651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata508Open in IMG/M
3300018957|Ga0193528_10273207All Organisms → cellular organisms → Eukaryota → Sar575Open in IMG/M
3300018957|Ga0193528_10295806All Organisms → cellular organisms → Eukaryota → Sar541Open in IMG/M
3300018961|Ga0193531_10327164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata517Open in IMG/M
3300018981|Ga0192968_10156851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata587Open in IMG/M
3300018985|Ga0193136_10161023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata668Open in IMG/M
3300018985|Ga0193136_10208484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata583Open in IMG/M
3300018986|Ga0193554_10394854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300018989|Ga0193030_10291766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata529Open in IMG/M
3300018989|Ga0193030_10297237All Organisms → cellular organisms → Eukaryota → Sar523Open in IMG/M
3300018998|Ga0193444_10161086Not Available592Open in IMG/M
3300019004|Ga0193078_10159816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata570Open in IMG/M
3300019004|Ga0193078_10220841All Organisms → cellular organisms → Eukaryota → Sar505Open in IMG/M
3300019007|Ga0193196_10349062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata629Open in IMG/M
3300019010|Ga0193044_10256542All Organisms → cellular organisms → Eukaryota → Sar536Open in IMG/M
3300019011|Ga0192926_10248669All Organisms → cellular organisms → Eukaryota → Sar760Open in IMG/M
3300019011|Ga0192926_10265112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata735Open in IMG/M
3300019011|Ga0192926_10439223All Organisms → cellular organisms → Eukaryota → Sar546Open in IMG/M
3300019037|Ga0192886_10077287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata935Open in IMG/M
3300019037|Ga0192886_10323253Not Available514Open in IMG/M
3300019040|Ga0192857_10245009All Organisms → cellular organisms → Eukaryota → Sar594Open in IMG/M
3300019040|Ga0192857_10292367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300019040|Ga0192857_10344575Not Available517Open in IMG/M
3300019053|Ga0193356_10226118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata660Open in IMG/M
3300019053|Ga0193356_10299497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata565Open in IMG/M
3300019053|Ga0193356_10365124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata503Open in IMG/M
3300019055|Ga0193208_10559547All Organisms → cellular organisms → Eukaryota → Sar598Open in IMG/M
3300019055|Ga0193208_10607342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata570Open in IMG/M
3300019055|Ga0193208_10664742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata540Open in IMG/M
3300019055|Ga0193208_10691597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata527Open in IMG/M
3300019091|Ga0192935_1021166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata582Open in IMG/M
3300019091|Ga0192935_1021656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata574Open in IMG/M
3300019112|Ga0193106_1039771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata570Open in IMG/M
3300019112|Ga0193106_1049922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300019126|Ga0193144_1101206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata533Open in IMG/M
3300019134|Ga0193515_1067173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata630Open in IMG/M
3300019134|Ga0193515_1082314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata551Open in IMG/M
3300019143|Ga0192856_1059498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300019151|Ga0192888_10246427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata517Open in IMG/M
3300019152|Ga0193564_10250923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata513Open in IMG/M
3300031522|Ga0307388_11037738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata555Open in IMG/M
3300031522|Ga0307388_11186025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata520Open in IMG/M
3300031709|Ga0307385_10276475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata639Open in IMG/M
3300031709|Ga0307385_10324674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata586Open in IMG/M
3300031710|Ga0307386_10659206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata557Open in IMG/M
3300031710|Ga0307386_10664738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata555Open in IMG/M
3300031729|Ga0307391_10654720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata597Open in IMG/M
3300033572|Ga0307390_10831072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata583Open in IMG/M
3300033572|Ga0307390_11020680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine79.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine9.00%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water7.00%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water2.00%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water2.00%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009216Microbial communities of water from the North Atlantic ocean - ACM47EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300018555Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001618 (ERX1809464-ERR1739837)EnvironmentalOpen in IMG/M
3300018608Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002024 (ERX1782181-ERR1712102)EnvironmentalOpen in IMG/M
3300018616Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003003 (ERX1782367-ERR1711877)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018637Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000837 (ERX1782121-ERR1712056)EnvironmentalOpen in IMG/M
3300018648Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782304-ERR1712027)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018720Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000793 (ERX1789656-ERR1719302)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018758Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002171 (ERX1782363-ERR1712059)EnvironmentalOpen in IMG/M
3300018794Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782102-ERR1711992)EnvironmentalOpen in IMG/M
3300018807Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002356 (ERX1789611-ERR1719493)EnvironmentalOpen in IMG/M
3300018850Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001578 (ERX1782388-ERR1711941)EnvironmentalOpen in IMG/M
3300018854Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000076 (ERX1789602-ERR1719346)EnvironmentalOpen in IMG/M
3300018883Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001582 (ERX1789446-ERR1719492)EnvironmentalOpen in IMG/M
3300018903Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001499 (ERX1789636-ERR1719512)EnvironmentalOpen in IMG/M
3300018927Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125)EnvironmentalOpen in IMG/M
3300018929Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782134-ERR1712223)EnvironmentalOpen in IMG/M
3300018951Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001338 (ERX1782096-ERR1711860)EnvironmentalOpen in IMG/M
3300018957Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300019004Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782445-ERR1712173)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019091Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001510 (ERX1782237-ERR1711876)EnvironmentalOpen in IMG/M
3300019112Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000836 (ERX1782266-ERR1711948)EnvironmentalOpen in IMG/M
3300019126Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000695 (ERX1782402-ERR1712043)EnvironmentalOpen in IMG/M
3300019134Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782286-ERR1712165)EnvironmentalOpen in IMG/M
3300019143Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782306-ERR1712244)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300019152Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002717EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0099654_1013025713300006415LakeRSVEGGKYGPMGEDLFAQQCMDKHGVSKVEAFDVSTDGACEADRPEAQKKNKKYIPSCAGTETPSIHPFKKPEAYQKCLEESQR*
Ga0103951_1013188323300008832MarineMGEDLFAQKCMDLMGVAKQENFGLTTDGACPADRPAGQEKNKKFVPDCVGVSTPSIHPFKKPQAYAACWAQAATVQP*
Ga0103951_1043863513300008832MarineHGGGKYGPMGEDLFAQQCMDAYGVKKVEAFYLTTDGACPADRPEGQKKNKKYQPDCIGTTTPTIHPFKKPAEYFKCMGEAVSAVSWAAV*
Ga0103951_1069917713300008832MarineGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLREGTQ*
Ga0103951_1070175813300008832MarinePWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKFIPNCAGVSTPSIHPFKKPNAYAACWAQAAAVQP*
Ga0103951_1075287413300008832MarineGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRVGTQ*
Ga0103951_1081975813300008832MarineGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPTEQKKNKKFVPNCGGVSTPSIHPFKKPEAYRECWAQAASVH*
Ga0103882_1008175823300008834Surface Ocean WaterGKYGATGEDLFAQQCMDLMKVSKIENFALSTDGACEADRPADQRKNKKYIPDCHGVSTPSIHPFKKVEPYVKCYMAAKDVMN*
Ga0103706_1007342913300009022Ocean WaterKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCAGVSTPSIHPFKKPEMYAECWNQASSVQP*
Ga0103707_1008286513300009025Ocean WaterWKRGVLGGKYGPMGEDLFAQKCLDKAGVAKLEAFDLTTDGACEADRPTEERKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH*
Ga0103842_104785913300009216River WaterGVLGGKYGPMGEDLFAQKCMDMLGVGRQENWMLTTDGACQADRPEEEKHNKKYVPPCEGVSTPTIHPYKKPDMYRKCWQQAVEA*
Ga0103842_105445513300009216River WaterQKCMDMVGVAKQENFGLTTDGACEADRPAYQKKNKKFIPSCVGVSTPSIHPFKKPKEYAACWAQAASVQP*
Ga0103878_103350013300009274Surface Ocean WaterQFGVHGGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPDCAGVSTPSIHPFKKPEKYAECWNQASSVQP*
Ga0103879_1003248413300009276Surface Ocean WaterPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKFIPNCAGVSTPSIHPFKKPEAYAACWAQAASVQP*
Ga0103879_1003943113300009276Surface Ocean WaterMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPDCAGVSTPSIHPFKKPEKYAECWNQASSVQP*
Ga0103879_1004100723300009276Surface Ocean WaterMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPEGQKKNKKFVPTCAGVSTPSIHPFKKPEAYRECWAQAASVQP*
Ga0103879_1004720113300009276Surface Ocean WaterDNCYSSLPWKVGVHGGKHGPMGEDLFAQKCMDMIGVAKQENFGLTTDGACEADRPAYQKKNKKFIPSCVGVSTPSIHPFKKPKDYAACWAQAASVQP*
Ga0103879_1004839413300009276Surface Ocean WaterKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPVGQEKNKKYIPNCAGVSTPSIHPFKKPQAYAECWAQAASVQP*
Ga0193296_10535713300018555MarineTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQKKNKKFVPDCGGVSTPSIHPFKKPEAYRKCWAQAASVQP
Ga0193415_102223813300018608MarineFATLVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCAGVSTPSIHPFKKPEMYAECWNQASSVQP
Ga0193064_102289413300018616MarineKAGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPDCAGVSTPSIHPFKKPEKYAECWNQASSVQP
Ga0193064_102882813300018616MarineGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKFIPDCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193355_103209513300018628MarineLVNNLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACESDRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0192914_101521913300018637MarineECYSSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193445_103636813300018648MarineVNNLDTCYTSLPWKVGVHGGKYGPMGEDPMGEDLFAQKCMDLMGVAKQENFGLTTDGACPADRPAGQEKNKKYIPDCAGVSTPSIHPFKKPQAYAACWAQAADQP
Ga0193445_103764713300018648MarineVNNLDTCYTSLPWKVGVHGGKYGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACPADRPAGQEKNKKYIPSCAGVSTPSIHPFKKPQAYAACWAQAAGQP
Ga0193445_104186213300018648MarineVNNLDTCYTSLPWKVGVHGGKYGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACPADRPAGQEKNKKYIPSCAGVSTPSIHPFKKPQAYAACWAQAADQP
Ga0192969_105291213300018649MarineVDNLDSCYYSLPWKVGVHDGKYGPMGEDLFAQKCMDMMGVSRQENFLLTTDGACPADRPVGQEKNKKYIPDCKGVSTPSIHPFKKPEHYAKCMDEAAEAWP
Ga0192866_107217213300018720MarineLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKDPTKYSECWEAAKDFQP
Ga0192866_107217513300018720MarineLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKEPTKYSECWEAAKDFQP
Ga0192866_107531813300018720MarineGGKFGPMGEDLFAQKCMDMLGVGRQENFALTTDGACEADRPVGQEKNKKYVPECDGVSTPSIHPFKKPDAWVKCWEKAKDVPN
Ga0192974_107212313300018739MarineKYGPMGEDLFAQKCMDMLGVSKQENWLLTTDGACPADRPEGQKKDKKFIPNCAGVSTPSIHPFKKPAMYAKCMEEASTAWPR
Ga0193534_107104513300018741MarineDNVDTCYDAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKEPSKYSECWEAAKDFQP
Ga0193058_107017613300018758MarineSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPTEEKKNKKFIPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193357_108617513300018794MarineGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPIDQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193441_109325313300018807MarinePWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPDGQEKNKKYIPSCAGVSTPSIHPFKKPQAYAECWAQAASVQP
Ga0193273_106059613300018850MarineWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACESDRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0193273_106540213300018850MarineLPWKVGVHGGKHGPMGEDLFAQKCMDMVGVAKQENFGLTTDGACEADRPAYQKKNKKFIPSCVGVSTPSIHPFKKPKEYAACWAQAASVQP
Ga0193214_110619113300018854MarineMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0193276_110231913300018883MarineSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKFIPNCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193244_107420213300018903MarineGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGEEKNKKYIPNCVGVSTPSIHPFKKPQAYAACWAQAASVQP
Ga0193244_109049613300018903MarineDNCYNRLPWKVGIHGGKYGPMGEDLFAQQCMDMMGVAKQENFDLTTDGACPADRPEGEKKNKKFVPDCNGVNTPTIHPFKKPAKWLECWNEAR
Ga0193244_109217213300018903MarineHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACPADRPAGQEKNKKFVPNCVGVSTPSIHPFKKPQAYAACWAQAATVQP
Ga0193244_109839413300018903MarineVNSLDTCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193244_110075413300018903MarineCYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRAVGQEKNKKFIPDCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193244_110174013300018903MarineLDTCYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQKKNKKFVPNCAGVSTPSIHPFKKPEAYRECWAQAASVQP
Ga0193083_1006419913300018927MarineYYSLPWKVGVHGGKYGPMGEDLFAQKCMDMMGVSRQENFLLTTDGACPADRPKGQEKNKKFIPDCKGVSTPSIHPFKKPAMYAKCMDEASEAWP
Ga0192921_1023580313300018929MarineGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0192921_1023584213300018929MarineGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKFIPDCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193128_1013188813300018951MarineKCMDLMGVAKQENFGLTTDGACPADRPAGQEKNKKFIPKCDGVSTPSIHPFKKPHAYAACWAQAASVQP
Ga0193128_1018065113300018951MarineSKQAFASLVNNLDNCYSSLPWKVGVHGGKHGPMGEDLFAQKCMDMIGVAKQENFGLTTDGACEADRPAYQKKNKKFIPSCVGVSTPSIHPFKKPKDYAACWAQAASVQP
Ga0193528_1027320713300018957MarinePWKVGVHGGKHGPMGEDLFAQKCMDMVGVAKQENFGLTTDGACEADRPAYQKKNKKFIPSCVGVSTPSIHPFKKPKEYAACWAQAASVQP
Ga0193528_1029580613300018957MarineKVGVHGGKHGPMGEDLFAQKCMDMVGVAKQENFGLTTDGACEADRPAYQKKNKKFIPSCVGVSTPSIHPFKKPKEYAACWAQAASVQP
Ga0193531_1032716423300018961MarineLDTCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPDCAGVSTPSIHPFKKPEKYAECWNQASSVQP
Ga0192968_1015685113300018981MarineNLDNCYSALPWKVGVHDGKYGPMGEDLFAQKCMDMLGVSKQENWLLTTDGACPADRPEGQKKDKKFIPNCAGVSTPSIHPFKKPAMYAKCMEEASTAWPR
Ga0193136_1016102313300018985MarineMENCKFVDWGYFGNLEVFSKQAFASLVNNLDNCYSSLPWKVGVHGGKHGPMGEDLFAQKCMDMIGVAKQENFGLTTDGACEADRPAYQKKNKKFIPSCVGVSTPSIHPFKKPKDYAACWAQAASVQP
Ga0193136_1020848413300018985MarineHGHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0193554_1039485413300018986MarineKQAFAALVNNLDNCYSSLPWKVGVHGGKHGPMGEDLFAQKCMDMIGVAKQENFGLTTDGACEADRPAYQKKNKKFIPSCVGVSTPSIHPFKKPKDYAACWAQAASVQP
Ga0193030_1029176613300018989MarineAIDWKLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKEPSKYSECWEAAKDFQP
Ga0193030_1029723713300018989MarineYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPTEEKKNKKFIPNCAGVSTPSIHPFKKPEAYRECWAQAASVH
Ga0193444_1016108613300018998MarineVNNLDTCYTSLPWKVGVHGGKYGPMGEDPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCAGVSTPSIHPFKKPEAYAECWAQAASVQP
Ga0193078_1015981613300019004MarineGKYGPMGEDLFAQKCMDLLGVAKQENFGLTMDGACEADRPAGQEKNKKYIPTCAGVSAPSIHPFKKPDAYAACWNEANSVHP
Ga0193078_1022084113300019004MarineVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPVGQEKNKKYIPSCAGVSTPSIHPFKKPQAYAECWAQAASVQP
Ga0193196_1034906213300019007MarineHGPMGEDLFAQKCMDLMGVAKQENFALTTDGACPADRPVGQERNKKFVPDCGGVSTPSIHPFKKPQAYAACWAQAASVQP
Ga0193044_1025654213300019010MarineLGVHGGKYGPMGEDLFAQQCMDMMKVSKQENFMLSTDGACEADRPEGQKKNKKFIPNCAGVSTPSIHPLKEPSKYSECWEAAKDFQP
Ga0192926_1024866913300019011MarineLDECYTSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQKKNKKFIPSCAGVSTPSIHPFKKPE
Ga0192926_1026511213300019011MarineKVGVHGGKHGPMGEDLFAQKCMDLMGVSRQENFGLSTDGACEADRPAGEEKNKKYIPSCAGVSTPSIHPFKKPEAYAACWAQAASSQP
Ga0192926_1043922313300019011MarineHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPVDQKKNKKFIPSCAGVSTPSIHPFNKPEAYAACWAQAASVQP
Ga0192926_1044174113300019011MarineQKCMDLLGVAKQENFGLTTDGACESDRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0192886_1007728713300019037MarineQAFRTLTANLDHCYEAIPWKIGVHNGKYGPMGEDLFAQKCMDLMGVAKQENFHLTTDGACEADRPEGEKKNKKFTPKCAGVTTPTIHPFKKPELYFKCMDEAANAYI
Ga0192886_1032325313300019037MarinePMGEDLFAQKCMDMLGVGRQENFALTTDGACEADRPVGQEKNNKYVPSCAGVSTPSIHPFKQPMAWVNCWEEAKDVSNA
Ga0192857_1024500913300019040MarineKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADEKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0192857_1029236713300019040MarineCYSSLPWKVGVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPDCAGVSTPSIHPFKKPEKYAECWNQASSVQP
Ga0192857_1034457513300019040MarineMIGVAKQENFGLTTDGACEADRPAYQKKNKKFIPSCVGVSTPSIHPFKKPKDYAACWAQAASVQP
Ga0193356_1022611813300019053MarineVHEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQANAVPLSGLRPGTQ
Ga0193356_1029949713300019053MarineKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCEGVTTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0193356_1036512413300019053MarineKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPEGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQASSVPLSGLRAGTQ
Ga0193208_1055954713300019055MarineHGGKHGPMGEDLFAQKCMDLMGVAKQENFALTTDGACPADRPVGQEKNKKFVPDCVGVSTPSIHPFKKPQAYAACWAQAASVQP
Ga0193208_1060734213300019055MarineLDQCYTQLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPVGQEKNKKYVPTCAGVSTPSIHPFKKPQAYAECWAQAASVQP
Ga0193208_1066474213300019055MarineLDQCYTQLPWKVGVHGGKHGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPVGQEKNKKYVPTCAGVSTPSIHPFKKPQAYADCWAQAASVQP
Ga0193208_1069159713300019055MarineLDQCYTQLPWKVGVHGGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPDGQEKNKKYVPTCAGVSTPSIHPFKKPQAYAECWAQAASVQP
Ga0192935_102116613300019091MarineGYFGNLEVFSKQAFATLVNSLDACYHSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0192935_102165613300019091MarineNNLDKCYNSLPWKVGVHGGKHGPMGEDLFAQKCMDMVGVAKQENFGLTTDGACEADRPAYQKKNKKFIPSCVGVSTPSIHPFKKPKEYAACWAQAASVQP
Ga0193106_103977113300019112MarineGGKHGPMGEDLFAQKCMDMVGVAKQENFGLTTDGACEADRPAYQKKNKKFIPSCVGVSTPSIHPFKKPKEYAACWAQAASVQP
Ga0193106_104992213300019112MarineGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193144_110120613300019126MarineTLLTQMEDCYAGMDWKVGIKNGKYGPMGEDLFAQKCMDRHGVKKVERFDLTRDGACPADRPKDQRKNKKYIPSCVGATTVTVHPFKKPSAYFKCMEEADQAFPR
Ga0193515_106717323300019134MarineEGKYGPMGEDLFAQKCMDLLGVAKQENFGLTTDGACEADRPQGQEKNKKYIPNCEGVSTPSIHPFKKPEAYAACWAQANSVPLSGLRAGTQ
Ga0193515_108231413300019134MarineKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGEEKNKKYIPNCVGVSTPSIHPFKKPQAYAACWAQAASVQP
Ga0192856_105949813300019143MarineAFATLVNNLDTCYSSLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPADQKKNKKFIPSCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0192888_1024642713300019151MarineVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKYIPNCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0193564_1025092313300019152MarineLPWKVGVHGGKHGPMGEDLFAQKCMDLMGVAKQENFGLTTDGACEADRPAGQEKNKKFIPTCAGVSTPSIHPFKKPEAYAACWAQAASVQP
Ga0307388_1103773813300031522MarinePWKVGVHDGKYGPMGEDLFAQKCMDMMGVSRQENFLLTTDGACPADRPEGQEKNKKYIPDCKGVSTPSIHPFKKPAMYAKCMDEAAEAWP
Ga0307388_1118602513300031522MarineGKYGPMGEDLFAQKCMDMLGVSKQENWLLTTDGACPADRPEGQKKDKKFIPNCAGVSTPSIHPFKKPAMYAKCMDEASTAWPR
Ga0307385_1027647513300031709MarineKQAFTTLVDNLDSCYYSLPWKVGVHDGKYGPMGEDLFAQKCMDMMGVSRQENFLLTTDGACPADRPVGQEKNKKYIPDCKGVSTPSIHPFKKPEHYAKCMDEAAEAWP
Ga0307385_1032467413300031709MarineLPWKVGVLEGKYGPMGEDLFAQKCMDLMGVGKQEMFELTTDGACPADRPKGQEKNKKYTPTCAGTSTPSIHPFKKPEAYFKCMDEAASAWP
Ga0307386_1065920613300031710MarineYSLPWKVGVHDGKYGPMGEDLFAQKCMDMMGVSRQENFQLTTDGACPADRPKGQEKNKKYIPDCSGVSTPSIHPFKKPEMYAKCMDEATTFFP
Ga0307386_1066473813300031710MarineHDGKYGPMGEDLFAQKCMDMLGVSKQENWLLTTDGACPADRPEGQKKDKKFIPNCAGVSTPSIHPFKKPAMYAKCMEEASTAWPR
Ga0307391_1065472013300031729MarineFTTLVDNLDSCYYSLPWKVGVHDGKYGPMGEDLFAQKCMDMMGVSRQENFQLTTDGACPADRPKGQEKNKKYIPDCSGVSTPSIHPFKKPEMYAKCMDEATTFFP
Ga0307390_1083107213300033572MarinePWKVGVHDGKYGPMGEDLFAQKCMDMMGVSRQENFQLTTDGACPADRPKGQEKNKKYIPDCSGVSTPSIHPFKKPEMYAKCMDEATTFFP
Ga0307390_1102068013300033572MarineGKYGPMGEDLFAQKCMDMLGVSKQENWLLTTDGACPADRPEGQKKDKKFIPNCAGVSTPSIHPFKKPAMYAKCMEEASTAWPR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.