NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105121

Metagenome / Metatranscriptome Family F105121

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105121
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 56 residues
Representative Sequence VVDTMDQTPEESLQAVLTRLVELGYLESDEVMVEGDRVHSGLTDLRVHDTGHVVKEN
Number of Associated Samples 98
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.00 %
% of genes near scaffold ends (potentially truncated) 92.00 %
% of genes from short scaffolds (< 2000 bps) 91.00 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.000 % of family members)
Environment Ontology (ENVO) Unclassified
(30.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.47%    β-sheet: 9.41%    Coil/Unstructured: 74.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF00478IMPDH 18.00
PF12867DinB_2 16.00
PF00534Glycos_transf_1 12.00
PF06897DUF1269 3.00
PF04015DUF362 3.00
PF00732GMC_oxred_N 3.00
PF00117GATase 2.00
PF00916Sulfate_transp 2.00
PF03054tRNA_Me_trans 1.00
PF07690MFS_1 1.00
PF05066HARE-HTH 1.00
PF01583APS_kinase 1.00
PF01850PIN 1.00
PF00528BPD_transp_1 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG2006Uncharacterized conserved protein, DUF362 familyFunction unknown [S] 3.00
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 3.00
COG4803Uncharacterized membrane proteinFunction unknown [S] 3.00
COG0659Sulfate permease or related transporter, MFS superfamilyInorganic ion transport and metabolism [P] 2.00
COG2233Xanthine/uracil permeaseNucleotide transport and metabolism [F] 2.00
COG2252Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) familyNucleotide transport and metabolism [F] 2.00
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 1.00
COG0529Adenylylsulfate kinase or related kinaseInorganic ion transport and metabolism [P] 1.00
COG3343DNA-directed RNA polymerase, delta subunitTranscription [K] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms76.00 %
UnclassifiedrootN/A24.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908041|P3_CLC_ConsensusfromContig125390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria778Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105812152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → unclassified Mycolicibacterium → Mycolicibacterium sp. YH-11956Open in IMG/M
3300001991|JGI24743J22301_10125291Not Available565Open in IMG/M
3300004058|Ga0055498_10108781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300004463|Ga0063356_104783345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300004643|Ga0062591_102991510Not Available502Open in IMG/M
3300005339|Ga0070660_101056144All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300005354|Ga0070675_102245515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300005355|Ga0070671_100072863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2869Open in IMG/M
3300005439|Ga0070711_101028794Not Available707Open in IMG/M
3300005543|Ga0070672_100214377All Organisms → cellular organisms → Bacteria → Terrabacteria group1613Open in IMG/M
3300005545|Ga0070695_100264300All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300005553|Ga0066695_10454698Not Available789Open in IMG/M
3300005554|Ga0066661_10853932All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300005556|Ga0066707_10983081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300005713|Ga0066905_101297641Not Available655Open in IMG/M
3300005719|Ga0068861_100094928All Organisms → cellular organisms → Bacteria2361Open in IMG/M
3300005719|Ga0068861_100899580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria838Open in IMG/M
3300005764|Ga0066903_104623000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium733Open in IMG/M
3300005985|Ga0081539_10355188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium615Open in IMG/M
3300006577|Ga0074050_12066762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria934Open in IMG/M
3300006580|Ga0074049_10036681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1077Open in IMG/M
3300006581|Ga0074048_12171967All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300006796|Ga0066665_10111432All Organisms → cellular organisms → Bacteria2023Open in IMG/M
3300006806|Ga0079220_10662227All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300006844|Ga0075428_100043119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4961Open in IMG/M
3300006853|Ga0075420_100859331All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300006914|Ga0075436_100915059All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300009153|Ga0105094_10540679Not Available678Open in IMG/M
3300009156|Ga0111538_11407858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria879Open in IMG/M
3300009162|Ga0075423_12203460Not Available599Open in IMG/M
3300009823|Ga0105078_1010189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1000Open in IMG/M
3300009840|Ga0126313_11671977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300010037|Ga0126304_10172696Not Available1406Open in IMG/M
3300010323|Ga0134086_10488071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M
3300010335|Ga0134063_10227345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium883Open in IMG/M
3300010337|Ga0134062_10058632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1584Open in IMG/M
3300010399|Ga0134127_11007532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria893Open in IMG/M
3300011996|Ga0120156_1062390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium675Open in IMG/M
3300012159|Ga0137344_1012043Not Available1308Open in IMG/M
3300012200|Ga0137382_10591115Not Available792Open in IMG/M
3300012356|Ga0137371_10152965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1808Open in IMG/M
3300012908|Ga0157286_10173417Not Available706Open in IMG/M
3300012915|Ga0157302_10033051All Organisms → cellular organisms → Bacteria1379Open in IMG/M
3300012955|Ga0164298_10570767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium771Open in IMG/M
3300012958|Ga0164299_11142368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300012984|Ga0164309_11163337All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300012986|Ga0164304_10492794All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300013306|Ga0163162_12500110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300015258|Ga0180093_1095442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300015371|Ga0132258_11385889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1776Open in IMG/M
3300017792|Ga0163161_10428069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1066Open in IMG/M
3300017965|Ga0190266_11042896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300017997|Ga0184610_1101328Not Available913Open in IMG/M
3300018031|Ga0184634_10481162Not Available556Open in IMG/M
3300018061|Ga0184619_10534822All Organisms → cellular organisms → Bacteria → Terrabacteria group514Open in IMG/M
3300018081|Ga0184625_10669821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300018465|Ga0190269_11219633Not Available593Open in IMG/M
3300018466|Ga0190268_10777524Not Available720Open in IMG/M
3300019233|Ga0184645_1037398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria913Open in IMG/M
3300019356|Ga0173481_10315286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → unclassified Mycolicibacterium → Mycolicibacterium sp. YH-1733Open in IMG/M
3300021073|Ga0210378_10084577Not Available1240Open in IMG/M
3300021073|Ga0210378_10131160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria971Open in IMG/M
3300021337|Ga0210341_1276313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria762Open in IMG/M
3300024056|Ga0124853_1220114All Organisms → cellular organisms → Bacteria2445Open in IMG/M
3300025167|Ga0209642_10473122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium695Open in IMG/M
3300025174|Ga0209324_10180362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1420Open in IMG/M
3300025313|Ga0209431_10047014All Organisms → cellular organisms → Bacteria3349Open in IMG/M
3300025325|Ga0209341_10271830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1401Open in IMG/M
3300025326|Ga0209342_11211813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300025925|Ga0207650_10984503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria717Open in IMG/M
3300025933|Ga0207706_11320510All Organisms → cellular organisms → Bacteria → Terrabacteria group595Open in IMG/M
3300025986|Ga0207658_11884345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300026023|Ga0207677_11982294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300026118|Ga0207675_100025420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5512Open in IMG/M
3300026121|Ga0207683_12051725Not Available520Open in IMG/M
3300026307|Ga0209469_1040211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1518Open in IMG/M
3300027870|Ga0209023_10576818Not Available664Open in IMG/M
3300027909|Ga0209382_10125570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2990Open in IMG/M
3300028380|Ga0268265_12296649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300028381|Ga0268264_10150608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2085Open in IMG/M
3300028707|Ga0307291_1029415All Organisms → cellular organisms → Bacteria1279Open in IMG/M
3300028708|Ga0307295_10125375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300028782|Ga0307306_10134460Not Available679Open in IMG/M
3300028803|Ga0307281_10418167Not Available515Open in IMG/M
3300028810|Ga0307294_10418613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300028812|Ga0247825_11467305Not Available501Open in IMG/M
3300028828|Ga0307312_10569858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria749Open in IMG/M
3300028884|Ga0307308_10365337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium691Open in IMG/M
3300028889|Ga0247827_10622506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium694Open in IMG/M
3300031547|Ga0310887_10402183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium806Open in IMG/M
3300031949|Ga0214473_11504674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium679Open in IMG/M
3300031997|Ga0315278_11216317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria738Open in IMG/M
3300032002|Ga0307416_103288314All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300032075|Ga0310890_11596101Not Available539Open in IMG/M
3300032177|Ga0315276_10732313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1060Open in IMG/M
3300032256|Ga0315271_11594223Not Available562Open in IMG/M
3300032397|Ga0315287_11700890Not Available706Open in IMG/M
3300033521|Ga0316616_100712377All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300034090|Ga0326723_0545665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.00%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment4.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil4.00%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment3.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.00%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.00%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.00%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.00%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.00%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.00%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.00%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.00%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.00%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.00%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.00%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908041Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009823Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011996Permafrost microbial communities from Nunavut, Canada - A39_65cm_12MEnvironmentalOpen in IMG/M
3300012159Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015258Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1DaEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300019233Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021337Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.425 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024056Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025174Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300027870Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P3_CLC_009234702124908041SoilPENPELVLDTMIESPEESLQNMLTKLKELGRIQDDIVMVQGDRMHSGLTDLRVADTGHVVKES
INPhiseqgaiiFebDRAFT_10581215213300000364SoilEAPEHPELVLNTLEETPQESLQFVLTTLVKLGYLDSAEQLVEGDRLHSGMTDLRVHDTGHVVEEA*
JGI24743J22301_1012529123300001991Corn, Switchgrass And Miscanthus RhizosphereELVVDTMTETPEESLQNVLRALVKLGYLGSDEVMVQGDRMHSGLTDLRVADTGHVVKES*
Ga0055498_1010878123300004058Natural And Restored WetlandsDTMVQTPRESLQAVLTELVELGYLETDEVMVEGGRLHSGLTDLRVHESGNVVDES*
Ga0063356_10478334523300004463Arabidopsis Thaliana RhizosphereVDTMTETPEESLQNVLRTLVKLGYLESDEVMVQGDRMHSGLTDLRVADSGQVVKES*
Ga0062591_10299151023300004643SoilSLQRTLTKLQELGYLEDDSVLAEGDRLHSGLTDLRVHETGHVVREN*
Ga0070660_10105614413300005339Corn RhizosphereENPELVVDTMTETPEESLQNVLRALVKLGYLGSDEVMVQGDRMHSGLTDLRVADTGHVVKES*
Ga0070675_10224551513300005354Miscanthus RhizospherePELVLDTMVESPGGSLQRTLTRLQELGYLEDDSILVEGDRLHSGLTDLRVHETGHVISES
Ga0070671_10007286313300005355Switchgrass RhizosphereSLQNVLRALVKLGYLGSDEVMVQGDRMHSGLTDLRVADTGHVVKES*
Ga0070711_10102879423300005439Corn, Switchgrass And Miscanthus RhizosphereLVVDTMTETPEESLQNVLTALVKLGYLDSDEVMVQGDRMHSGLTDLRVADTGHVVKES*
Ga0070672_10021437713300005543Miscanthus RhizosphereLVVDTMTETPEESLQNVLRALVKLGYLGSDEVMVQGDRMHSGLTDLRVADTGHVVKES*
Ga0070695_10026430013300005545Corn, Switchgrass And Miscanthus RhizosphereVVDTMVETPEASLQRVLTTLAALGYLDSDQPMIQGDRVHSGMTDLRVQESGHVVKEH*
Ga0066695_1045469813300005553SoilDSLRNVLTELMKLGYLETDEPMVEGDRLHSGMTDLRVHRTGHVVEEA*
Ga0066661_1085393223300005554SoilAPEAPELVLDTMVEEPLESLQNVLRKLAELGYVEDSKLLVEGDRLHSGLTDLRITDTGHVAEGR*
Ga0066707_1098308123300005556SoilVDTMVETPEESLQRVLTTLRTLGYLGSDETMIEGDRVHSGMTDLRVHESGHVVKEH*
Ga0066905_10129764133300005713Tropical Forest SoilLDTMVETPEESLQRTLTKLKGLGYLEDDEILVEGDRAHSGMTDLRLTETGDVAKGR*
Ga0068861_10009492813300005719Switchgrass RhizosphereELVVDTMVETPEASLQRVLTTLAALGYLDSDQPMIQGDRVHSGMTDLRVQESGHVVKEH*
Ga0068861_10089958013300005719Switchgrass RhizosphereVDTMTETPEESLRQVLSTLVKLGYLDSDESMVQGDRVHSGLTDLRVADSGHVVKES*
Ga0066903_10462300033300005764Tropical Forest SoilETPDESLRNVLTALMKLGYLGSDEPMVAGDRLHSGMTDLRVHDTGHVVNEG*
Ga0081539_1035518813300005985Tabebuia Heterophylla RhizosphereLVLDTMVETPEDSLRNVLRTLEELGYVDDATPLVEGDRVHSGLTDLRITDTGHIAEGR*
Ga0074050_1206676223300006577SoilELMLDTMVETPERSLQRTLTKLKELGYLDDDTILVEGDRLHSGLTDLRVRDTGHVLNET*
Ga0074049_1003668123300006580SoilPQGSLQRTLTKLQELGYLEDDSVLVEGDRLHSGLTDLRVHETGHVVNES*
Ga0074048_1217196723300006581SoilPEHPELVVDTETQTPEESLQAVLVRLTELGHLAESSIHVSGDRVHSGLTDLRVAETGHVIKEH*
Ga0066665_1011143233300006796SoilMVETPEESLQRVLTTLRTLGYLESDETMIEGDRVHSGMTDLRVHETGHVVKER*
Ga0079220_1066222723300006806Agricultural SoilMNETPEESLQNVLRALVKLGYLDSDEVMVPGDRMHSGLTDLRVADTGHVVKES*
Ga0075428_10004311913300006844Populus RhizosphereTMVETPEDSLQRTLTRLKELGYLENDTPLIEGDRKHSGMTDLRLTETGDVAKGR*
Ga0075420_10085933123300006853Populus RhizospherePAHPELVLDTMVESPEGSLQRTLSRLKELGYLEDDEPKVEGDRSHSGMTDLRLTDTGHVAEGR*
Ga0075436_10091505913300006914Populus RhizosphereYEAPEHPELVLDTLQETPQESLQKVLTTLMRLGYVESDEPMIEGDRLHSGMTDLRVHQSGHVVEEG*
Ga0105094_1054067913300009153Freshwater SedimentQTPEESLQNVLTTLKDLGYIEDDAILVEGDRMHSGLTDLRVHDSGHVVKEH*
Ga0111538_1140785813300009156Populus RhizosphereLDTMVESPEESLQRTLTALKGLGYLDDDTPMVEGDRIHSGMTDLRLTETGEVAKGR*
Ga0075423_1220346013300009162Populus RhizosphereSPQESLQRTLTRLQELGYLEDDSVLVEGDRLHSGLTDLRVHETGHVVREN*
Ga0105078_101018923300009823Groundwater SandYEVPEHPELVLDTMVESPQGSLQRTLTKLQELGYLEDDSVLVEGDRLHSGLTDLRVHETGHVVREN*
Ga0126313_1167197713300009840Serpentine SoilESPDGSLQRVLTRLKELGYLDDDAILVEGDRVHSGLTDLRVHETGHVVREK*
Ga0126304_1017269613300010037Serpentine SoilELVLDTMVESPEGSLQRVLTRLKELGYLDDDAILVEGDRVHSGLTDLRVHETGHVVREN*
Ga0134086_1048807123300010323Grasslands SoilPYEAPEDPELVVDTLEETPVESLRKVLKTLQRLGYLDSAEPMVEGDRLHSGMTDLRVHDTGHVVREN*
Ga0134063_1022734513300010335Grasslands SoilVDTMVETPEESLQRVLTTLRTLGYLESDQTMIEGDRVHSGMTDLRVHETGHVVKEH*
Ga0134062_1005863213300010337Grasslands SoilAPYEAPEHPELVVDTMVETPEGSLQRVLTTLTALGYLESDEPMVEGDRVHSGMTDLRVHETGHVVKEH*
Ga0134127_1100753223300010399Terrestrial SoilQESLQRTLTRLQELGYLEDDSVLVEGDRLHSGLTDLRVHETGHVVREN*
Ga0120156_106239023300011996PermafrostMVQTPEESLQRVLTTLRTLGYLESDEPMIEGDRVHSGMTDLRVHETGHVVKEH*
Ga0137344_101204323300012159SoilENPELVLDTMVESPERSLQRTLTRLKELGYLDDDTILVEGDRLHSGLTDLRVRDTGHVVQES*
Ga0137382_1059111523300012200Vadose Zone SoilETPEGSLQRVLTTLTTLGYLDNDVTMIEGERVHSGMTDLRVHETGHVVKEH*
Ga0137371_1015296513300012356Vadose Zone SoilEGSLQRVLTTLRTLGYLECDESMIEGDRVHAGMTDLRVHETGHVVKED*
Ga0157286_1017341713300012908SoilEVPENPELVVDTMTETPEESLEQVLTTLVKLGYIERDEAMVQGDRIHSGLTDLRVADSGHVVKES*
Ga0157302_1003305123300012915SoilVPENPELVVDTMTETPEESLQNVLRTLVKLGYLDSDEVMVEGDRMHSGLTDLRVADSGHVVKES*
Ga0164298_1057076713300012955SoilPEASLQRVLTTLAALGYLESDEPMIRGDRVHSGMTDLRVHETGHVVKEH*
Ga0164299_1114236813300012958SoilELVVDTMTETPEESLRQVLSTLVKLGYLDSDEAMVQGDRVHSGLTDLRVADSGHVVKES*
Ga0164309_1116333723300012984SoilVVDTMTETPEESLQNVLTALVKLGYLDSDEVKVQGDRMHSGLTDLRVADTGHVVKES*
Ga0164304_1049279433300012986SoilPEASLQRVLTTLAALGYLDSDQPMIQGDRVHSGMTDLRVQESGHVVKEH*
Ga0163162_1250011013300013306Switchgrass RhizosphereSLQGVLMTLAALAYLDSDQPMIQGDRVHSGMTDLRVQESGHVVKEH*
Ga0180093_109544223300015258SoilDTMVEAPAQSLQRVLTRLKELGYLDDDTILVEGDRLHSGLTDLRVRDTGHVVQES*
Ga0132258_1138588933300015371Arabidopsis RhizosphereYEVPENPELVVDTMNETPEDSLQNVLRTLVKLGYLDSDEVMVQGDRMHSGLTDLRVADTGHVVKES*
Ga0163161_1042806913300017792Switchgrass RhizosphereVPENPELVVDTMTETPEESLQNVLRALVKLGYLGSDEVMVQGDRMHSGLTDLRVADTGHVVKES
Ga0190266_1104289623300017965SoilVPESPELMVDTLVETPEESLQHVLTALVKLGYLETDEVMVEGDRVHSGQTDLRVHDTGHVVKEG
Ga0184610_110132813300017997Groundwater SedimentQSLQRVLTTLKELGYLDDDKILVEGDRLHSGLTDLRVRDTGHVVQES
Ga0184634_1048116213300018031Groundwater SedimentRSLQRTLTKLKELGYLDDDTILVEGDRLHSGLTDLRIHETGHVVNET
Ga0184619_1053482223300018061Groundwater SedimentEASLQHVLTTLAALGYLESDQPMIQGDRVHSGMTDLRVQETGHVVKEH
Ga0184625_1066982113300018081Groundwater SedimentAPERPELVLDTMVESPEGSLQRTLTKLQELGYLEDDSVLVEGDRLHSGLTDLRVHETGHVVSES
Ga0190269_1121963323300018465SoilSLRRTLSRLKELGYLEDDAVLVEGEPLHSGLTDLRIHEAGHVVREG
Ga0190268_1077752423300018466SoilYEVPERPELVLDTMVESPEGSLQRTLTRLQELGYLEDDSILVEGDRLHSGLTDLRVHETGHVISES
Ga0184645_103739813300019233Groundwater SedimentPELVLDTMVESPEESLQRALSRLKELGYLDDDSVLVEGDRPHSGLTDLRVHETGQVVKES
Ga0173481_1031528623300019356SoilPELVVDTMTETPEESLEQVLTTLVKLGYIERDEAMVQGDRIHSGLTDLRVADSGHVVKES
Ga0210378_1008457723300021073Groundwater SedimentESLQRALSRLKELGYLDDDSVLVEGDRLHSGLTDLRVHETGQVVKES
Ga0210378_1013116013300021073Groundwater SedimentVPENPELVLDTMVEAPAQSLQRVLTTLMELGYLNDNTILVEEDRLHSGLTDLRVHETGHVVRES
Ga0210341_127631313300021337EstuarineVDTMSESPEESLQNVLTKLKDLGRIDSDEVMIEGDRVHSGLTDLRVDSAGTVIKEH
Ga0124853_122011413300024056Freshwater WetlandsMVETPEESLQKVLTRLVELGYLEDDAVMVEGDRLHSGMTDLRVHDSGHVVKEH
Ga0209642_1047312233300025167SoilPEAPELVVDTMVESPEESLQKVLTRLVELGYLEDDTVMVEGDRLHSGMTDLRVRDTGHVVKEN
Ga0209324_1018036213300025174SoilVVDTMDQTPEESLQAVLTRLVELGYLESDEVMVEGDRVHSGLTDLRVHDTGHVVKEN
Ga0209431_1004701443300025313SoilELVVDTMDQTPEESLQAVLTRLVELGYLESDEVMVEGDRVHSGLTDLRVHDTGHVVKEN
Ga0209341_1027183033300025325SoilPEDPELVVDTMDQTPEESLQAVLTRLVELGYLESDEVMVEGDRVHSGLTDLRVHDTGHVVKEN
Ga0209342_1121181323300025326SoilTPEQSLQAVLTRLVELGYLEDDTMMVEGDRLHSGLTDLRVHDTGHVVKES
Ga0207650_1098450313300025925Switchgrass RhizosphereERPELTVDTLVETPEESLQHVLTTLVKLGYLDTDEVMVEGDRVHSGQTDLRVHDTGHVVKEG
Ga0207706_1132051023300025933Corn RhizospherePELVVDTMVETPEASLQRVLTTLAALGYLDSDQPMIQGDRVHSGMTDLRVQESGHVVKEH
Ga0207658_1188434513300025986Switchgrass RhizospherePELVVDTMTETPEESLQNVLRALVKLGYLGSDEVMVQGDRMHSGLTDLRVADTGHVVKES
Ga0207677_1198229423300026023Miscanthus RhizospherePENPELVVDTMTETPEESLQNVLRTLVKLGYLDSDEVMVEGDRMHSGLTDLRVADSGHVVKES
Ga0207675_10002542083300026118Switchgrass RhizosphereYEAPEHPELVVDTMVETPEASLQGVLTTLAALGYLDSDQPMIQGDRVHSGMTDLRVQESGHVVKEH
Ga0207683_1205172523300026121Miscanthus RhizosphereENPELVVDTMTETPEESLQNVLRTLVKLGYLDSDEVMVQGDRMHSGLTDLRVADSGHVVKES
Ga0209469_104021133300026307SoilMVETPEGSLQRVLTTLTALGYLESDEPMVEGDRVHSGMTDLRVHETGHVVKEH
Ga0209023_1057681813300027870Freshwater And SedimentEESLQHVLTTLVKHGYLASDEVLIEGDRVHSGQTDLRVHDTGHVVKES
Ga0209382_1012557013300027909Populus RhizosphereESPQGSLQRTLTRLQELGYLEDDSVLVEGDRLHSGLTDLRVHETGHVVREN
Ga0268265_1229664923300028380Switchgrass RhizosphereVPERPELVLDTMVESPEGSLQRTLTRLQELGYLEDDSVLVEGDRLHSGLTDLRVHETGHVVREN
Ga0268264_1015060813300028381Switchgrass RhizosphereVESPQESLQRTLTRLQELGYLEDDSVLVEGDRLHSGLTDLRVHETGHVVREN
Ga0307291_102941533300028707SoilTIVETPEGSLQRVLTTLAALGYVESDQPMIKGDRMHSGMTDLRVQETGHVVKEH
Ga0307295_1012537523300028708SoilLTVDTLVETPEDSLQHVLTTLVKLGYLDTDEVMVQGDRVHSGQTDLRVHDTGHVVKEG
Ga0307306_1013446013300028782SoilEESLQNVLRTLVKLGYIDSDDVMVQGDRMHSGLTDLRVADTGHVVKES
Ga0307281_1041816713300028803SoilETPDESLRRTLSRLKELGYLEDDAVLVEGERLHSGLTDLRIHETGHVVREA
Ga0307294_1041861313300028810SoilHPELVVDTMVETPEGSLQRVLTTLAALGYVESDQPMIKGDRMHSGMTDLRVQETGHVVKE
Ga0247825_1146730513300028812SoilTMVESPKESLQKTLTKLKELGHIEDDAVLVEGDRQHSGLTDLRVHEAGHVVKES
Ga0307312_1056985823300028828SoilPEGSLQRTLTKLHELGYLEDDSVLVEGDRLHSGLTDLRVHETGHVVSEN
Ga0307308_1036533713300028884SoilMVETPEESLQHVLTTLTTLGYLESDQPMIEGDRVHSGMTDLRVHETGHVVKEH
Ga0247827_1062250623300028889SoilEASLQRVLTTLTALGYLESDQPMIQGDRMHSGMTDLRVQETGHVVKEH
Ga0310887_1040218323300031547SoilVPEDPELLLDTMVESPEESLRRTLGRLVELGYLEDDTVLVEGDRLHSGFTDLRVHDTGHVVEEN
Ga0214473_1150467413300031949SoilELVVDTMVQTPEESLQAVLTRLVELGYLESDEIMVEGDRLHSGLTDLRVHDTGHVVKEN
Ga0315278_1121631723300031997SedimentSPEESLQVVLSKLKELGRIGSDEVMIEGDRVHSGLTDLRVDSATGNVVKES
Ga0307416_10328831413300032002RhizosphereLMLDTENETPEESLANVLSTLKRLGYIDDDTVMVTGDRLHSGLTDLRVGDTGHVVKEH
Ga0310890_1159610113300032075SoilMVETPEGSLRRTLSRLKELAYLEDDSVLAEGERLHSGLTDLRIHETGHVVREG
Ga0315276_1073231313300032177SedimentVDTMVESPEESLQKVLEKLADLGYIESAEVMIEGDRVHSGMTDLRTTDTGHVKKEH
Ga0315271_1159422323300032256SedimentPYEVPEDPELVVDTLVESPEESLQHVLTTLVTLGHLDTDEVMIEGDRVHSGQTDLRVHDTGHVVKEA
Ga0315287_1170089013300032397SedimentTETESPEESLQTVLTRLKELGRIDDDTVHVTGDRLHSGLTDLRVADSGHVVKEH
Ga0316616_10071237733300033521SoilESLANVLTKLKELGWIESDEVMIEGDRVHSGLTDLRVAESGHVVKES
Ga0326723_0545665_7_1773300034090Peat SoilVDTLAQTPEESLQSLLTRLAELGYLDSDEVLIEGDRIHSGMTDLRVHETGHVVKES

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.