NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F105031

Metagenome Family F105031

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105031
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 82 residues
Representative Sequence MTIIRPHAKPTLWWLFPWSYARTLHTAANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITP
Number of Associated Samples 59
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.00 %
% of genes near scaffold ends (potentially truncated) 39.00 %
% of genes from short scaffolds (< 2000 bps) 72.00 %
Associated GOLD sequencing projects 55
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(15.000 % of family members)
Environment Ontology (ENVO) Unclassified
(29.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(48.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 57.55%    β-sheet: 0.00%    Coil/Unstructured: 42.45%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF01464SLT 13.00
PF00145DNA_methylase 8.00
PF04404ERF 6.00
PF13481AAA_25 1.00
PF01555N6_N4_Mtase 1.00
PF14743DNA_ligase_OB_2 1.00
PF05136Phage_portal_2 1.00
PF00772DnaB 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 8.00
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 1.00
COG0863DNA modification methylaseReplication, recombination and repair [L] 1.00
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 1.00
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 1.00
COG5511Phage capsid proteinMobilome: prophages, transposons [X] 1.00


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.00 %
UnclassifiedrootN/A17.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002161|JGI24766J26685_10010226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1022517Open in IMG/M
3300002161|JGI24766J26685_10034381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021195Open in IMG/M
3300004282|Ga0066599_100943312Not Available622Open in IMG/M
3300004481|Ga0069718_10016585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102765Open in IMG/M
3300004481|Ga0069718_10079770Not Available1145Open in IMG/M
3300004481|Ga0069718_10087526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102988Open in IMG/M
3300004481|Ga0069718_10129332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1022153Open in IMG/M
3300004481|Ga0069718_16306846All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage525Open in IMG/M
3300005805|Ga0079957_1019943All Organisms → Viruses → Predicted Viral4716Open in IMG/M
3300006030|Ga0075470_10039048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021464Open in IMG/M
3300006641|Ga0075471_10013903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1024872Open in IMG/M
3300006641|Ga0075471_10024939All Organisms → cellular organisms → Bacteria → Proteobacteria3499Open in IMG/M
3300006802|Ga0070749_10558648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102620Open in IMG/M
3300006805|Ga0075464_10152717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021357Open in IMG/M
3300006805|Ga0075464_10951840Not Available537Open in IMG/M
3300006863|Ga0075459_1001275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1024046Open in IMG/M
3300006920|Ga0070748_1200610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102729Open in IMG/M
3300006920|Ga0070748_1313618All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage556Open in IMG/M
3300006920|Ga0070748_1324307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102545Open in IMG/M
3300007177|Ga0102978_1086358Not Available3901Open in IMG/M
3300008116|Ga0114350_1031056All Organisms → cellular organisms → Bacteria2113Open in IMG/M
3300008117|Ga0114351_1058730All Organisms → cellular organisms → Bacteria3105Open in IMG/M
3300008117|Ga0114351_1414996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102563Open in IMG/M
3300008120|Ga0114355_1156540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102800Open in IMG/M
3300008266|Ga0114363_1016854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1023288Open in IMG/M
3300008266|Ga0114363_1090847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021117Open in IMG/M
3300008266|Ga0114363_1123105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102898Open in IMG/M
3300008266|Ga0114363_1132140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102852Open in IMG/M
3300008266|Ga0114363_1202183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102608Open in IMG/M
3300008267|Ga0114364_1011507Not Available8300Open in IMG/M
3300008339|Ga0114878_1202147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102664Open in IMG/M
3300008450|Ga0114880_1048428All Organisms → Viruses → Predicted Viral1807Open in IMG/M
3300008450|Ga0114880_1130203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102933Open in IMG/M
3300008450|Ga0114880_1145084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102861Open in IMG/M
3300009037|Ga0105093_10365707All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage780Open in IMG/M
3300009091|Ga0102851_11254025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage818Open in IMG/M
3300009419|Ga0114982_1165010All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage684Open in IMG/M
3300012352|Ga0157138_1000273Not Available11998Open in IMG/M
3300012352|Ga0157138_1014671All Organisms → Viruses → Predicted Viral1274Open in IMG/M
3300012352|Ga0157138_1016091All Organisms → Viruses → Predicted Viral1209Open in IMG/M
3300013372|Ga0177922_11298462Not Available543Open in IMG/M
3300017707|Ga0181363_1054630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102710Open in IMG/M
3300020151|Ga0211736_10316318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102741Open in IMG/M
3300020159|Ga0211734_10730744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102500Open in IMG/M
3300020159|Ga0211734_10758845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102729Open in IMG/M
3300020160|Ga0211733_11082596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1022041Open in IMG/M
3300020161|Ga0211726_11022371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102513Open in IMG/M
3300020161|Ga0211726_11022421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102799Open in IMG/M
3300020162|Ga0211735_10643680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102624Open in IMG/M
3300020162|Ga0211735_11290978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102589Open in IMG/M
3300020172|Ga0211729_10395087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102507Open in IMG/M
3300020172|Ga0211729_11325556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102793Open in IMG/M
3300021961|Ga0222714_10001361All Organisms → cellular organisms → Bacteria27555Open in IMG/M
3300021961|Ga0222714_10072686All Organisms → cellular organisms → Bacteria2272Open in IMG/M
3300021961|Ga0222714_10139605All Organisms → Viruses → Predicted Viral1469Open in IMG/M
3300021961|Ga0222714_10273836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102936Open in IMG/M
3300021961|Ga0222714_10451019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102669Open in IMG/M
3300021962|Ga0222713_10430842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102804Open in IMG/M
3300021962|Ga0222713_10597220All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage644Open in IMG/M
3300021963|Ga0222712_10009013Not Available9344Open in IMG/M
3300021963|Ga0222712_10098051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1022057Open in IMG/M
3300022179|Ga0181353_1008619All Organisms → Viruses → Predicted Viral2521Open in IMG/M
3300022190|Ga0181354_1098541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102954Open in IMG/M
3300024289|Ga0255147_1061697Not Available716Open in IMG/M
3300024351|Ga0255141_1012477All Organisms → Viruses → Predicted Viral1328Open in IMG/M
3300024500|Ga0255143_1005828All Organisms → Viruses → Predicted Viral2112Open in IMG/M
3300024500|Ga0255143_1038323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102790Open in IMG/M
3300024503|Ga0255152_1039111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102865Open in IMG/M
3300024503|Ga0255152_1084455Not Available539Open in IMG/M
3300025445|Ga0208424_1000409Not Available5209Open in IMG/M
3300025585|Ga0208546_1127075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102555Open in IMG/M
3300025848|Ga0208005_1239087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102560Open in IMG/M
3300025872|Ga0208783_10001593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA10213332Open in IMG/M
3300025872|Ga0208783_10028158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1022692Open in IMG/M
3300026455|Ga0255155_1060744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102629Open in IMG/M
3300026455|Ga0255155_1083887Not Available517Open in IMG/M
3300026457|Ga0255160_1075513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102554Open in IMG/M
3300026478|Ga0255156_1050611Not Available761Open in IMG/M
3300027467|Ga0255154_1081699Not Available706Open in IMG/M
3300027805|Ga0209229_10023975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1022649Open in IMG/M
3300027805|Ga0209229_10058673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021720Open in IMG/M
3300031565|Ga0307379_10755998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102864Open in IMG/M
3300031566|Ga0307378_10249840All Organisms → Viruses → Predicted Viral1707Open in IMG/M
3300031758|Ga0315907_10097875All Organisms → cellular organisms → Bacteria2516Open in IMG/M
3300031758|Ga0315907_10155809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021932Open in IMG/M
3300031758|Ga0315907_10158213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1021915Open in IMG/M
3300031857|Ga0315909_10053464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1023720Open in IMG/M
3300031857|Ga0315909_10136030All Organisms → cellular organisms → Bacteria2049Open in IMG/M
3300031857|Ga0315909_10404832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102976Open in IMG/M
3300031857|Ga0315909_10617224Not Available721Open in IMG/M
3300032050|Ga0315906_10097190All Organisms → Viruses → Predicted Viral2936Open in IMG/M
3300032050|Ga0315906_10415866All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1165Open in IMG/M
3300032116|Ga0315903_10556707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102891Open in IMG/M
3300032116|Ga0315903_10972758All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Stenotrophomonas → Stenotrophomonas maltophilia group → Stenotrophomonas maltophilia597Open in IMG/M
3300032116|Ga0315903_11132092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102534Open in IMG/M
3300033557|Ga0316617_100470748All Organisms → Viruses → Predicted Viral1132Open in IMG/M
3300034082|Ga0335020_0001735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA10215158Open in IMG/M
3300034104|Ga0335031_0381204Not Available892Open in IMG/M
3300034116|Ga0335068_0072857All Organisms → cellular organisms → Bacteria1966Open in IMG/M
3300034356|Ga0335048_0185295Not Available1160Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous15.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater12.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater11.00%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater11.00%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton10.00%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water9.00%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment5.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.00%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment4.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater3.00%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil2.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.00%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.00%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater1.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.00%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006863Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007177Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008339Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300012352Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37EnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300024289Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8hEnvironmentalOpen in IMG/M
3300024351Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0hEnvironmentalOpen in IMG/M
3300024500Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300024503Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300025445Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026455Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8hEnvironmentalOpen in IMG/M
3300026457Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8hEnvironmentalOpen in IMG/M
3300026478Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027467Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8hEnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24766J26685_1001022653300002161Freshwater And SedimentMTIIRPNAKPALWWLFPWSYARTLHTAANALRALTDRQDKALEMQAHIIVDQSEEIANLRRRVEDLNEIIHGYRPGL*
JGI24766J26685_1003438113300002161Freshwater And SedimentQPLHNTIPPMPDPSHRPYKPMTIIRPNDKPALWWLFPWSYASTLHTAANALRALCDRQDKALEMQAHIIVDQSEEIANLRRRVTELDEVINGPRI*
Ga0066599_10094331213300004282FreshwaterMTIIRPNAMPRLWWLFPWSYARTLHTAANALRALTDKQEEALTIQAHIIVDQSEEIANLRRRVEDLSEIIHGHRI*
Ga0069718_1001658523300004481SedimentMPDPSHRPYQPMTIIRPNAKPALWWLFPWSYARTLHIAANALRALCDRQERALEMQSHVIADQSEEISFLRQRVDDLNDSIIRGTAITPDAQPHRDETIHE*
Ga0069718_1007977013300004481SedimentMTIIRPHDKPALWWLFPWSYARTLHTAANALRALCDRQERALEMQSHVISDQSEEISFLRQRVDDLNDSIIRGCIIRDA
Ga0069718_1008752623300004481SedimentMTIIRPHDKPRLWWLFPWSYASTLHTAANALRSLSDRQDKALEMQAHIIVDQSEEISFLRQRVNDLNDSIIRGKAITPDAHPHE*
Ga0069718_1012933263300004481SedimentPMTIIRPHDKPRLWWLFPWSYARTLHTAANALRALTDRQDKAIEMQAHIIVDQSEEIANLRRRVTELDEVINGPRI*
Ga0069718_1630684613300004481SedimentLWWLFPWSYASTLHMAANALRAMCDRQDQALTMQAHIIADQSEEISFLRQRVDDLNDSIIRGCIIRDAGPIPEDSES*
Ga0079957_101994323300005805LakeMTIIRPHAKPTLWWLFPWSYARTLHTAANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITPDAQPHD*
Ga0075470_1003904843300006030AqueousPMPDPSHRPYKPMTIIRPNAKPALWWLFPWSYARTLHTAANALRALCDRQDKALEMQAHIIVDQSEEIANLRRRVEDLNEIIHGYRPGL*
Ga0075471_1001390333300006641AqueousMTIIRPHTKPRLWWLFPWSYARTLHNAANALRALTDRQDRALEMQAHIIVDQSEEISFLRQRVDDLNDAIVRGKAITPDAHPHE*
Ga0075471_1002493963300006641AqueousMTIIRPNAKPALWWLFPWSYARTLHTAANALRALCDRQDKALEMQAHIIVDQSEEIANLRRRVEDLNEIIHGYRPGL*
Ga0070749_1055864813300006802AqueousWWLFPRSYARTLHTAANALRALCDRQDKALEMQAHIIVDQSEEIANLRRRVEDLNEIIHGYRPGL*
Ga0075464_1015271733300006805AqueousMTIIRPNAKPRLWWLFPWSYARTLHTAANALRALCDRQDKALEMQAHIIVDQSEEIANLRRRVEDLNEALHGPRI*
Ga0075464_1095184023300006805AqueousMPCPSHKPYEPMTIIRPHDKPRLWWLFPWSYARTLHTAANALRALTDRQERALDMQAHIIVDQSEEISFLR
Ga0075459_100127583300006863AqueousMPDPSHRPYKPMTIIRPNAKPALWWLFPWSYARTLHTAANALRALCDRQDKALEMQAHIIVDQSEEIANLRRRVEDLNEIIHGYRPGL*
Ga0070748_120061013300006920AqueousPSHRPYKPMTIIRPNAKPRLWWLFPWSYARTLHTAANALRALTDRQDKALEMQAHIIVDQSEEISFLRQRVDDLNDAIVRGKAITPDAHPHE*
Ga0070748_131361823300006920AqueousPPMPDPSHRPYKPMTIIRPNAKPALWWLFPWSYARTLHTAANALKALSDRQDDALTLQAHIIADQSEEIHFLRQRVDDLNDAIIRGGAITPDAGPIPEDSES*
Ga0070748_132430713300006920AqueousPMPDPSHRPYKPMTIIRPNTKPRLWWLFPWSYARTLHTAANALRALCDRQDKALEMQAHIIVDQSEEIANLRRRVEDLNEIIHGYRPGL*
Ga0102978_108635883300007177Freshwater LakeMPCPSHRPYEPMTIIRPNAKPAFWWLVPWSYARTLHTAANALRALTDRQEEAIRLQAHIIVDQSEEIANLRRRVEDLNEIIHGPRL*
Ga0114350_103105633300008116Freshwater, PlanktonMTIIRPDSMPRLWWLVPWAYARQLHRNANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGK
Ga0114351_105873033300008117Freshwater, PlanktonMTIIRPDSMPRLWWLVPWAYARQLHRNANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITPDAQPHD*
Ga0114351_141499623300008117Freshwater, PlanktonMTIIRPHAKPTLWWLFPWSYARTLHTAANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITPDAHPHE*
Ga0114355_115654033300008120Freshwater, PlanktonMTIIRPHAKPTLWWLFPWSYARTLHTAANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITPDA
Ga0114363_101685483300008266Freshwater, PlanktonMTIIRPNAKPRLWWLFPWSYARTLHTAANALRALTDRQDKALEMQAHIIVDQSEEISFLRQRVDDLNDAIVRGKAITPDAHPHE*
Ga0114363_109084713300008266Freshwater, PlanktonWWLFPWSYARTLHTAANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITPDAQPHE*
Ga0114363_112310533300008266Freshwater, PlanktonMTIIRPHAKPTLWWLFPWSYARTLHNAANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITPDAQPHE*
Ga0114363_113214013300008266Freshwater, PlanktonSHRPYDPMTIIRPHAKPTLWWLFPWSYARTLHTAANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITPDAHPHE*
Ga0114363_120218313300008266Freshwater, PlanktonWWLFPWSYARTLHTAANALRALSDRQDEALTMQAHIIADQSEEIANLRRRVEDLNEAIIAGKAITPDAHPHE*
Ga0114364_101150733300008267Freshwater, PlanktonMTIIRPHDKPALWWLFPWSYAQTLHTAANALRALCDRQERALEMQSHVISDQSEEISFLRQRVDDLNDSIIRGTAITPDAQPHRDETIHE*
Ga0114878_120214713300008339Freshwater LakeSHRPYDPMTIIRPHAKPTLWWLFPWSYARTLHTAANALRALSDRQDEALTMQAHIIADQSEEIANLRRRVEDLNEAIIAGKAITPDAHPHE*
Ga0114880_104842853300008450Freshwater LakeMTIIRPHAKPTLWWLFPWSYARTLHNAANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITPDAQPHD*
Ga0114880_113020333300008450Freshwater LakeMTIIRPHAKPTLWWLFPWSYARTLHTAANALRALSDRQDEALTMQAHIIADQSEEIANLRRRVEDLNEAIIAGKAITPDAHPHE*
Ga0114880_114508413300008450Freshwater LakeMTIIRPHDKPALWWLFPWSYARTLHTAANALRALTDRQDKAIEMQAHIIVDQSEEISFLRQRVDDLNDSIIRGASIKDAGPIPEESES*
Ga0105093_1036570723300009037Freshwater SedimentMTIIRPNTKPAFWWLFPWSYARTLHTAANALRALTDSQEQAIVLQKHVIADQSEEIANLRRRVEDLNEIIHGPRI*
Ga0102851_1125402523300009091Freshwater WetlandsMTIIRPNTKPAFWWLFPWSYARTLHTAANALRALSDSQEEAIVLQKHIIADQSEEIANLRRRVEDLNEIIHGPRI*
Ga0114982_116501023300009419Deep SubsurfaceMHIIKPDSMPRFWWLFPWSYALTLHAAANALKAMCDRQDRVLTMQANIIDGQSEEIHFLRQRVDDLNDAIIRGASIKDAGPIPEDSES*
Ga0157138_1000273113300012352FreshwaterMHIIRPNTKPALWWLFPWSYARTLHTAANALRALSDSQEEAIVLQKHIIADQSEEIANLRRRVEDLNEIIHGPRI*
Ga0157138_101467153300012352FreshwaterMTIIRPNTKPALWWLFPWSYARTLHTAANALRALSDSQEQAIVLQKHIIADQSEEIANLRRRVEDLNEIIHGP
Ga0157138_101609123300012352FreshwaterMTIIRPNTKPALWWLFPWSYARTLHTAANALRALSDSQEEAIVLQKHIIADQSEEIANLRRRVEDLSEIIHGPRI*
Ga0177922_1129846223300013372FreshwaterMTIIRPNAKPALWWLFPWSYARTLHTAANALRALTDRQERALDMQAHIIVDQSEEISFLRQRVNDLNDAIVRGKAITPDAQPHRDETIHE*
Ga0181363_105463023300017707Freshwater LakeMTIIRPHAKPTLWWLFPWSYARTLHNAANALRALSDRQDEALTMQAHIIADQSEEIANLRRRVEDLNEIIHGPRI
Ga0211736_1031631813300020151FreshwaterMPDPSHRPYKPMTIIRPNDKPRLWWLFPWSYARTLHTAANALRALCDRQERALDMQAHIIVDQSEEITNLRQEVTRLASSREHW
Ga0211734_1073074423300020159FreshwaterYKPMTIIRPHDKPALWWLFPWSYASTLHTAANALRALTDRQERALEMQSHVISDQSEEISFLRQRVDDLNDSIIRGTAITPDAQPHRDETIHE
Ga0211734_1075884523300020159FreshwaterMTIIRPHDKPPLWWLFPWSYARTLHTAANALRSLSDRQDKALEMQAHIIADQSEEISFLRQRVDDLNDSIIRGSAITPDAQPHRDETIHE
Ga0211733_1108259633300020160FreshwaterMTIIRPHDKPRLWWLFPWSYARTLHMAANALRAMCDRQDQALTMQAHIIADQSEEISFLRQRVDDLNDSIIRGSAITPDAQPHRDDTIHE
Ga0211726_1102237123300020161FreshwaterWWLFPWSYARTLHTAANALRALTDRQERALEMQSHVISDQSEEISFLRQRVDDLNDSIIRGTAITPDAQPHRDETIHE
Ga0211726_1102242133300020161FreshwaterWWLFPWSYARTLHTAANALRALTDRQERALEMQAHIIVDQSEEIHFLRQRVDDLNDAIIRGASIKDAGPIPEDSES
Ga0211735_1064368023300020162FreshwaterMPDPSHRPYKPMTIIRPHDKPALWWLFPWSYARTLHTAANALRALTDRQERALEMQSHVISDQSEEISFLRQRVDDLNDSIIRGTAITPDAQPHRDETIHE
Ga0211735_1129097823300020162FreshwaterMPDPSHRPYKPMTIIRPHDKPPLWWLFPWSYASTLHTAANALRALTDRQERALEMQSHVISDQSEEISFLRQRVDDLNDAIIRGASIKDAGPIPEDSES
Ga0211729_1039508713300020172FreshwaterSHRPYKPMTIIRPHDKPPLWWLFPWSYASTLHTAANALRALTDRQERALEMQAHIIVDQSEEIHFLRQRVDDLNDAIIRGASIKDAGPIPEDSES
Ga0211729_1132555613300020172FreshwaterHRPYKPAMTIIRPHDKPPLWWLFPWSYARTLHSAANALRALCDRQDKALEMQAHIIVDQSEEIANLRRRVEDLNEIIHGPRI
Ga0222714_10001361203300021961Estuarine WaterMPDPSHRPYDPMTIIRPHAKPRLWWLFPWSYARTLHTAANALRALTDRQDKALEMQAHIIVDQSEEIANLRRRVEDLNEALHGPRK
Ga0222714_1007268633300021961Estuarine WaterMTIIRPNTKPALWWLFPWSYARTLHMAANALRAMCDRQDRALEMQAHIIADQSEEIRFLRRRVEDLNDAIISGKAIVPDAQPNE
Ga0222714_1013960543300021961Estuarine WaterMPDPSHKPYEPPMTIIRPNTKPAFWWLFPWAYARTLHTAANALRALTDSQEQAIVLQKHIIADQSEEIANLRRRVEDLNEIIHGPRI
Ga0222714_1027383633300021961Estuarine WaterMTIIRPNTKPAFWWLFPWAYARTLHTAANALRALTDSQEQAIVLQKHIIADQSEEIANLRRRVEDLNEIIHGPRI
Ga0222714_1045101923300021961Estuarine WaterMPDPSHRPYKPMTIIRPHAKPALWWLFPWSYARTLHTAANALKALCDRQDRAIEMQAHIIVDQSEEIANLRRRVDDLNEALHGPRK
Ga0222713_1043084223300021962Estuarine WaterMTIIRPNTKPAFWWLFPWAYARTLHTAANALRALTDSQEQAIVLQKHVIADQSEEIANLRRRVEDLNEIIHGPRI
Ga0222713_1059722023300021962Estuarine WaterMTIIRPNTKPAFWWLFPWAYARTLHTAANALRALVDSQEQAIVLQKHVIADQSEEIANLRRRVEDLNEIIHGPRI
Ga0222712_10009013213300021963Estuarine WaterPPLTLLSPPMPDPSHRPYNPMTIIRPNTKPTLWWLFPWSYAQTLHMAANALKALCDRQDDALNLQAHIIADQSEEIRFLRQRVDDLNDAIVRGGAITPDAGPIPEDSES
Ga0222712_1009805133300021963Estuarine WaterMTIIRPNTKPALWWLFPWSYARTLHTAANALRALCDRQDRALEMQAHIIADQSEEIANLRRRVDDLNEALHGPRK
Ga0181353_100861923300022179Freshwater LakeMTIIRPHAKPTLWWLFPWSYARTLHNAANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITPDAQPHE
Ga0181354_109854133300022190Freshwater LakeMTIIRPHDKPALWWLFPWSYAITLHTAANALRSLCDRQERALEMQSHVISDQSEEISFLRQRVDDLNDSIIRGASIKDAGPIPEDSES
Ga0255147_106169723300024289FreshwaterMTIIRPNTKPALWWLFPWSYARTLHTAANALRALSDSQEEAIVLQKHIIADQSEEIANLRRRVEDLNEIIHGPRI
Ga0255141_101247713300024351FreshwaterMTIIRPNTKPAFWWLFPWSYARTLHTAANALRALSDSQEEAIVLQKHIIADQSEEIANLRRRVEDLNEIIHGPRI
Ga0255143_100582873300024500FreshwaterMTIIRPNTKPALWWLFPWSYARTLHTAANALRALSDSQEEAIVLQKHIIADQSEEIANLRRRVEDLNEIIHGSSLQAKV
Ga0255143_103832323300024500FreshwaterMPDPSHKPYQPMTIIRPNTKPAFWWLFPWSYARTLHTAANALRALCDSQEEAIVLQKHIIADQSEEIANLRRRVEDLNEIIHGPRI
Ga0255152_103911113300024503FreshwaterMTIIRPNTKPAFWWLFPWSYARTLHTAANALRALCDSQEEAIVLQKHIIADQSEEIANLRRRVEDL
Ga0255152_108445523300024503FreshwaterMTIIRPNTKPAFWWLFPWSYARTLHTAANALRALSDSQEEAIVLQKHIIADQSEEIANLRRRVEDLSEIIHGPRI
Ga0208424_1000409103300025445AqueousMPDPSHRPYKPMTIIRPNAKPALWWLFPWSYARTLHTAANALRALCDRQDKALEMQAHIIVDQSEEIANLRRRVEDLNEIIHGYRPGL
Ga0208546_112707523300025585AqueousMTIIRPHTKPRLWWLFPWSYARTLHNAANALRALTDRQDRALEMQAHIIVDQSEEISFLRQRVDDLNDAIVRGKAITP
Ga0208005_123908713300025848AqueousMTIIRPHTKPRLWWLFPWSYARTLHNAANALRALTDRQDRALEMQAHIIVDQSEEISFLRQRVDDLNDAIVRGKAIT
Ga0208783_1000159393300025872AqueousMTIIRPHTKPRLWWLFPWSYARTLHNAANALRALTDRQDRALEMQAHIIVDQSEEISFLRQRVDDLNDAIVRGKAITPDAHPHE
Ga0208783_1002815843300025872AqueousMTIIRPNAKPALWWLFPWSYARTLHTAANALRALCDRQDKALEMQAHIIVDQSEEIANLRRRVEDLNEIIHGYRPGL
Ga0255155_106074413300026455FreshwaterMTIIRPNTKPALWWIFPWSYARTLHTAANALRALSDSQEEAIVLQKHIIADQSEEIANLRRRVEDLNKPLE
Ga0255155_108388723300026455FreshwaterMTIIRPNTKPAFWWLFPWSYARTLHTAANALRALCDSQEEAIVLQKHIIADQSEEIANLRRRVEDLNEIIHGPRI
Ga0255160_107551333300026457FreshwaterMTIIRPNTKPALWWIFPWSYARTLHTAANALRALSDSQEEAIVLQKHIIADQSEEIANLRRRVEDLNKPLEW
Ga0255156_105061133300026478FreshwaterMTIIRPNTKPALWWLFPWSYARTLHTAANALRALSDSQEEAIVLQKHIIADQSEEIANLRRRVEDLNEIIHG
Ga0255154_108169913300027467FreshwaterMTIIRPNTKPALWWLFPWSYARTLHTAANALRALSDSQEEAIVLQKHIIADQSEEIANLRRRVEDL
Ga0209229_1002397523300027805Freshwater And SedimentMPDPSHRPYKPIMTIIRPNAKPALWWLFPWSYARTLHTAANALRALTDRQDKALEMQAHIIVDQSEEIANLRRRVEDLNEIIHGYRPGL
Ga0209229_1005867333300027805Freshwater And SedimentMPDPSHRPYKPMTIIRPNDKPALWWLFPWSYASTLHTAANALRALCDRQDKALEMQAHIIVDQSEEIANLRRRVTELDEVINGPRI
Ga0307379_1075599823300031565SoilMPDPSHRPYQPMTIIRPHDKPPLWWLFPWSYASTLHTAANALRSLSDRQDKALEMQAHIIADQSEEIANLRRRVEDLNEALHGPRK
Ga0307378_1024984033300031566SoilMPDPSHRPYQPMTIIRPHDKPALWWLFPWSYASTLHTAANALRSLSDRQDKALEMQAHIIADQSEEIANLRRRVEDLNEAIIRGKAITPDAHPHE
Ga0315907_1009787533300031758FreshwaterMTIIRPDSMPRLWWLVPWAYARQLHRNANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITPDAHPHE
Ga0315907_1015580953300031758FreshwaterPPMPDPSHRPYKPMTIIRPNAKPALWWLFPWSYARTLHTAANALRALTDRQDRAIEMQAHIIVDQSEEIANLRRRVEDLNEALHAPRK
Ga0315907_1015821363300031758FreshwaterMTIIRPHAKPTLWWLFPWSYARTLHTAANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITPDAHPHE
Ga0315909_1005346453300031857FreshwaterMTIIRPHAKPTLWWLFPWSYARTLHNAANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITPDAQPHD
Ga0315909_1013603033300031857FreshwaterMTIIRPDSMPRLWWLVPWAYARQLHRNANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITP
Ga0315909_1040483233300031857FreshwaterMTIIRPNAKPALWWLFPWSYARTLHTAANALRALTDRQDRAIEMQAHIIVDQSEEIANLRRRVEDLNEALHAPRK
Ga0315909_1061722423300031857FreshwaterMTIIRPHTKPPLWWLFPWSYARTLHSAANALKALCDRQDNALTLQAHIIADQSEEIQFLRQRVDDLNDAIIRGASVKDAGPIPEDSES
Ga0315906_1009719013300032050FreshwaterMTIIRPHAKPTLWWLFPWSYARTLHTAANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITP
Ga0315906_1041586623300032050FreshwaterMPDPSHRPYDPMTIIRPDSMPRLWWLVPWAYARQLHRNANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITP
Ga0315903_1055670743300032116FreshwaterWLFPWSYARTLHNAANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITPDAQPHE
Ga0315903_1097275813300032116FreshwaterMLWQPNGAAFQIMPDPSHRPYQPMTIIRPDSMPRLWWLFPWSYARTLHNAANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITPDAQPHD
Ga0315903_1113209223300032116FreshwaterMTIIRPDSMPRLWWLVPWAYARQLHRTANALRALSDRQDQALTMQAHIIVDQSEEIANLRRRVEDLNEAIIAGKAITPDAQPHD
Ga0316617_10047074833300033557SoilMTIIRPDSMPRLWWLVPWSYARTLHTAANALRALSDRQDEALTMQAHIIVDQSEEIANLRRRVEDLNEIIHGPRI
Ga0335020_0001735_2487_27413300034082FreshwaterMTIIRPNTKPPLWWLFPWSYAQTLHMAANALKALCDRQDDALTLQAHIIADQSEEIANLRQHIRILDDAIVRGRAITPDAQPHE
Ga0335031_0381204_87_3533300034104FreshwaterMTIIRPHTKPPLWWLFPWSYASTLHMAANALRAMCDRQDQALTMQAHIIADQSEEIHFLRQRVDDLDDAIIRGAVIKDAGPIPEDSES
Ga0335068_0072857_101_3283300034116FreshwaterMTIIKPESLPRLWWLFPWSYARTLHMAANALRAMTDRQDQALTTQARIIVDQSEEIANLRRRVEDLNEIIHGPRI
Ga0335048_0185295_931_11583300034356FreshwaterMTIIRPNTKPPLWWLFPWSYAQTLHMAANALKALCDRQDDALTLQAHIIADQSEEIANLRQHIRILDDAIVRGRAI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.