Basic Information | |
---|---|
Family ID | F104796 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 38 residues |
Representative Sequence | MDNDEATTSNDEGDRSTGDGESWLAEQARLVLLEDGS |
Number of Associated Samples | 78 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 91.84 % |
% of genes near scaffold ends (potentially truncated) | 12.00 % |
% of genes from short scaffolds (< 2000 bps) | 77.00 % |
Associated GOLD sequencing projects | 72 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (40.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (46.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.46% β-sheet: 0.00% Coil/Unstructured: 81.54% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF13561 | adh_short_C2 | 27.00 |
PF00463 | ICL | 27.00 |
PF02142 | MGS | 15.00 |
PF13714 | PEP_mutase | 10.00 |
PF00126 | HTH_1 | 3.00 |
PF00561 | Abhydrolase_1 | 3.00 |
PF02771 | Acyl-CoA_dh_N | 2.00 |
PF11084 | DUF2621 | 2.00 |
PF03466 | LysR_substrate | 2.00 |
PF00106 | adh_short | 1.00 |
PF14206 | Cys_rich_CPCC | 1.00 |
PF02325 | YGGT | 1.00 |
PF00441 | Acyl-CoA_dh_1 | 1.00 |
PF02770 | Acyl-CoA_dh_M | 1.00 |
PF01636 | APH | 1.00 |
PF01016 | Ribosomal_L27 | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG2224 | Isocitrate lyase | Energy production and conversion [C] | 27.00 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 4.00 |
COG0211 | Ribosomal protein L27 | Translation, ribosomal structure and biogenesis [J] | 1.00 |
COG0762 | Cytochrome b6 maturation protein CCB3/Ycf19 and related maturases, YggT family | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.00 % |
Unclassified | root | N/A | 9.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908016|OU_2_1_1_newblercontig80271 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300005181|Ga0066678_10149301 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
3300005184|Ga0066671_10612220 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300005552|Ga0066701_10344574 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300005553|Ga0066695_10071646 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
3300005554|Ga0066661_10002767 | All Organisms → cellular organisms → Bacteria | 7591 | Open in IMG/M |
3300005557|Ga0066704_10002258 | All Organisms → cellular organisms → Bacteria | 8860 | Open in IMG/M |
3300005578|Ga0068854_100041402 | All Organisms → cellular organisms → Bacteria | 3254 | Open in IMG/M |
3300005586|Ga0066691_10221568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1106 | Open in IMG/M |
3300005598|Ga0066706_11393961 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300006031|Ga0066651_10635587 | Not Available | 569 | Open in IMG/M |
3300006800|Ga0066660_10314401 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
3300006854|Ga0075425_101705502 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300009012|Ga0066710_100898838 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
3300009038|Ga0099829_10477128 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300009038|Ga0099829_10868346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 749 | Open in IMG/M |
3300009038|Ga0099829_11364564 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300009088|Ga0099830_11541984 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300009089|Ga0099828_10860298 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300009090|Ga0099827_10417607 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300009090|Ga0099827_10468871 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
3300009137|Ga0066709_100676577 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
3300010399|Ga0134127_10244201 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1697 | Open in IMG/M |
3300010399|Ga0134127_11742480 | Not Available | 698 | Open in IMG/M |
3300010401|Ga0134121_10769207 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300011998|Ga0120114_1000090 | All Organisms → cellular organisms → Bacteria | 32129 | Open in IMG/M |
3300012096|Ga0137389_11427524 | Not Available | 588 | Open in IMG/M |
3300012200|Ga0137382_10213462 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
3300012200|Ga0137382_10263674 | Not Available | 1196 | Open in IMG/M |
3300012200|Ga0137382_10449270 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300012203|Ga0137399_10144677 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
3300012203|Ga0137399_10217384 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
3300012206|Ga0137380_10308157 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300012208|Ga0137376_10065863 | All Organisms → cellular organisms → Bacteria | 3001 | Open in IMG/M |
3300012208|Ga0137376_10189290 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
3300012208|Ga0137376_10393822 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300012209|Ga0137379_10787624 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300012211|Ga0137377_10061284 | All Organisms → cellular organisms → Bacteria | 3503 | Open in IMG/M |
3300012211|Ga0137377_11255408 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300012285|Ga0137370_10013019 | All Organisms → cellular organisms → Bacteria | 4029 | Open in IMG/M |
3300012285|Ga0137370_10948209 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300012349|Ga0137387_11063846 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300012362|Ga0137361_10408173 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
3300012363|Ga0137390_10846033 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300012410|Ga0134060_1506876 | Not Available | 546 | Open in IMG/M |
3300012683|Ga0137398_11195979 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300012685|Ga0137397_10061553 | All Organisms → cellular organisms → Bacteria | 2708 | Open in IMG/M |
3300012918|Ga0137396_10116297 | All Organisms → cellular organisms → Bacteria | 1924 | Open in IMG/M |
3300012922|Ga0137394_10403904 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300012925|Ga0137419_10057676 | All Organisms → cellular organisms → Bacteria | 2533 | Open in IMG/M |
3300012925|Ga0137419_10827670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 759 | Open in IMG/M |
3300012927|Ga0137416_10187162 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
3300012927|Ga0137416_10393611 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
3300014157|Ga0134078_10278170 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300015241|Ga0137418_10033537 | All Organisms → cellular organisms → Bacteria | 4746 | Open in IMG/M |
3300015241|Ga0137418_10137218 | All Organisms → cellular organisms → Bacteria | 2166 | Open in IMG/M |
3300018028|Ga0184608_10138917 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300018061|Ga0184619_10021660 | All Organisms → cellular organisms → Bacteria | 2644 | Open in IMG/M |
3300018482|Ga0066669_10128547 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
3300018482|Ga0066669_12366758 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300019885|Ga0193747_1001584 | All Organisms → cellular organisms → Bacteria | 6077 | Open in IMG/M |
3300020004|Ga0193755_1133748 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300020015|Ga0193734_1048874 | Not Available | 780 | Open in IMG/M |
3300020018|Ga0193721_1043104 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
3300020022|Ga0193733_1042681 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
3300021080|Ga0210382_10463266 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300023058|Ga0193714_1003167 | All Organisms → cellular organisms → Bacteria | 2694 | Open in IMG/M |
3300025885|Ga0207653_10135770 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300026301|Ga0209238_1071227 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300026309|Ga0209055_1056703 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
3300026310|Ga0209239_1155234 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300026310|Ga0209239_1182765 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300026317|Ga0209154_1003249 | All Organisms → cellular organisms → Bacteria | 8860 | Open in IMG/M |
3300026326|Ga0209801_1158776 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300026327|Ga0209266_1264530 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300026328|Ga0209802_1096456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1338 | Open in IMG/M |
3300026529|Ga0209806_1008617 | All Organisms → cellular organisms → Bacteria | 5582 | Open in IMG/M |
3300027643|Ga0209076_1183886 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300027748|Ga0209689_1017959 | All Organisms → cellular organisms → Bacteria | 4449 | Open in IMG/M |
3300027875|Ga0209283_10033821 | All Organisms → cellular organisms → Bacteria | 3199 | Open in IMG/M |
3300027882|Ga0209590_10281821 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300027882|Ga0209590_10801603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 598 | Open in IMG/M |
3300028536|Ga0137415_10772523 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300028711|Ga0307293_10055378 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300028778|Ga0307288_10313689 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300028784|Ga0307282_10461082 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300028784|Ga0307282_10485066 | Not Available | 600 | Open in IMG/M |
3300028824|Ga0307310_10100799 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
3300028878|Ga0307278_10251732 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300028881|Ga0307277_10023002 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
3300028881|Ga0307277_10262287 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300028881|Ga0307277_10279156 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300028884|Ga0307308_10002124 | All Organisms → cellular organisms → Bacteria | 8117 | Open in IMG/M |
3300031058|Ga0308189_10106606 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300032180|Ga0307471_101862569 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300032180|Ga0307471_103263383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 575 | Open in IMG/M |
3300032180|Ga0307471_103335584 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300034644|Ga0370548_124685 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 40.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.00% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.00% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.00% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 1.00% | |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908016 | Sample 642 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
OU_01322360 | 2124908016 | MDNDEISTNDESDTTTSEGESWLAEQARLIWLEDGS | |
Ga0066678_101493011 | 3300005181 | Soil | LTMDNDDVTTTNDDLYSGADDPGESWLAEQARLVLLEDGG* |
Ga0066671_106122202 | 3300005184 | Soil | VTMDNDDVVISNDEADGSPDETGESWLAEQARLVLLEDGS* |
Ga0066701_103445742 | 3300005552 | Soil | MDDDEGAITYDGTDRGPEDRAESWLAEQARLLLLEDGW* |
Ga0066695_100716462 | 3300005553 | Soil | MDDDQAASTNDEGDRNTGEGESWLAEQARLVLLEDGS* |
Ga0066661_100027675 | 3300005554 | Soil | MDNDDVTTTNDDLYPGADDPGESWLAEQARLVLLEDGG* |
Ga0066704_1000225811 | 3300005557 | Soil | MDNDDVTTTNDDLYSRADDPGESWLAEQARLVLLEDG* |
Ga0068854_1000414025 | 3300005578 | Corn Rhizosphere | MDNDDVLMSNEADGSRDENGESWLAEQARLVLLEDGS* |
Ga0066691_102215682 | 3300005586 | Soil | MDNDDVTTTNDDLYPGADDPGESWLAEQARLVLLEDG* |
Ga0066706_113939611 | 3300005598 | Soil | MDNDDVTVTNDEGEAPADRGESWLAEQARLVLLEDGS* |
Ga0066651_106355872 | 3300006031 | Soil | MDNDDATTANDDVELNAGDSESWLAEQARLILLEDGG* |
Ga0066660_103144013 | 3300006800 | Soil | MDNDAVTTTNDDLYPGADDPGESWLAEQARLVLLEDG* |
Ga0075425_1017055022 | 3300006854 | Populus Rhizosphere | VDNDDVTLDNNDSNTDDPGESWLAEQARLVLLEDGR* |
Ga0066710_1008988382 | 3300009012 | Grasslands Soil | MDNDEATTSNDEGDRSTGDGESWLAEQARLVLLEDGS |
Ga0099829_104771282 | 3300009038 | Vadose Zone Soil | MDDDEAAGAYDEVDREAESAESWLAEQARLVLIEDGS* |
Ga0099829_108683462 | 3300009038 | Vadose Zone Soil | MDIDEIATTNDEAIGITGDGESWLAEQARLVLLEDGS* |
Ga0099829_113645642 | 3300009038 | Vadose Zone Soil | MDNDEAATTYDELNGEAEIGESWLAEQARLVLAEDGA* |
Ga0099830_115419842 | 3300009088 | Vadose Zone Soil | MDNDEAATTYDELNGEADIGESWLAEQARLVLAEDGA* |
Ga0099828_108602982 | 3300009089 | Vadose Zone Soil | MDNDEAAMTNDEVDRDSELGESWLAEQARLVLAEDGA* |
Ga0099827_104176072 | 3300009090 | Vadose Zone Soil | VTVDDDEAAITDEDADRGSDDRGESWLAEQARLVLLEDGS* |
Ga0099827_104688711 | 3300009090 | Vadose Zone Soil | MDNDEAETTYDELNGEAEIGESWLAEQARLVLAEDGA* |
Ga0066709_1006765772 | 3300009137 | Grasslands Soil | MDNDEATTSNDEGDRSTGDGESWLAEQARLVLLEDGS* |
Ga0134127_102442012 | 3300010399 | Terrestrial Soil | MTMDDDKTTTTNEDANRSSDNGAESWLAEQARLVLLEGI* |
Ga0134127_117424802 | 3300010399 | Terrestrial Soil | MDDDKATTTTDETDRGPDTRRESWLAEQARLVLLEGI* |
Ga0134121_107692073 | 3300010401 | Terrestrial Soil | MDNDEGVTNNDDLENNAGGESWLAEQARLILLEDGI* |
Ga0120114_100009031 | 3300011998 | Permafrost | MDNDDVPANNDKVDGDTGGESWLAEQARLILLEDGS* |
Ga0137389_114275242 | 3300012096 | Vadose Zone Soil | MDDDEAAGAYDEVDRQAERAESWLAEQARLVLLEDGS* |
Ga0137382_102134622 | 3300012200 | Vadose Zone Soil | MDNDDATTANDDVELNAGDSESWLAEQARLILLED |
Ga0137382_102636742 | 3300012200 | Vadose Zone Soil | MDNDDATTANDDLELNPGDAESWLAEQARLVLLEDGA* |
Ga0137382_104492702 | 3300012200 | Vadose Zone Soil | MDNDDATTANDDVELNSSDAESWLAEQARLVLLEDGS* |
Ga0137399_101446772 | 3300012203 | Vadose Zone Soil | MDDDDVTTYDPDSTGEDAGESWLAEQARLVLLEDGS* |
Ga0137399_102173842 | 3300012203 | Vadose Zone Soil | MDDDDGITYDNVDSTADDSGESWLAEQARLVLLEDGS* |
Ga0137380_103081572 | 3300012206 | Vadose Zone Soil | MDIDETATTNDEAVGITGDGESWLAEQARLVLLEDGS* |
Ga0137376_100658633 | 3300012208 | Vadose Zone Soil | MDNDEGTRDDEGERSTDDGESWLAEQARLVLLEDGS* |
Ga0137376_101892902 | 3300012208 | Vadose Zone Soil | MDNDDVTVTNDEGEAPADRSESWLAEQARLVLLEDGS* |
Ga0137376_103938222 | 3300012208 | Vadose Zone Soil | MDNDDATTADDDVELNAGDSESWLAEQARLILLEDGG* |
Ga0137379_107876241 | 3300012209 | Vadose Zone Soil | EGGVTMDIDETATTNDEAVGITGDGESWLAEQARLVLLEDGS* |
Ga0137377_100612845 | 3300012211 | Vadose Zone Soil | MDNDDVTVTNDEGEAPADRTESWLAEQARLVLLEDGS* |
Ga0137377_112554082 | 3300012211 | Vadose Zone Soil | MDNDEATTSNDEGERSTDDGESWLAEQARLVLLEDGS* |
Ga0137370_100130191 | 3300012285 | Vadose Zone Soil | MDNDETTTSEGTVTDGGDAGESWLAEQARLVLLEDGR* |
Ga0137370_109482091 | 3300012285 | Vadose Zone Soil | MDNDDATTADDDGELNVGDSESWLAEQARLVLLEDGA* |
Ga0137387_110638462 | 3300012349 | Vadose Zone Soil | MDDDQAASTNDEGDRNTGEGESWLAEQARLVLLEDGG* |
Ga0137361_104081731 | 3300012362 | Vadose Zone Soil | MDNDEVTVANDEGEGPADRGESWLAEQARLVLLEDGS* |
Ga0137390_108460332 | 3300012363 | Vadose Zone Soil | MMDIDETATTNDEAIGITGDGESWLAEQARLVLLEDGS* |
Ga0134060_15068762 | 3300012410 | Grasslands Soil | MDNDEATTSNDEGDRNTGEGESWLAEQARLVLLEDGS* |
Ga0137398_111959791 | 3300012683 | Vadose Zone Soil | MDNDDVLISNDEADGSRDENGESWLAEQARLVLLEDGA* |
Ga0137397_100615535 | 3300012685 | Vadose Zone Soil | MDDDDDATTYDNVDSTADEGGESWLAEQARLVLLEDGS* |
Ga0137396_101162974 | 3300012918 | Vadose Zone Soil | MDDDGITYDNVDSTADDSGESWLAEQARLVLLEDGS* |
Ga0137394_104039042 | 3300012922 | Vadose Zone Soil | MDDDDAITYDNVDSTADNSGESWLAEQARLVLLEDGS* |
Ga0137419_100576762 | 3300012925 | Vadose Zone Soil | MDDDDATTYDVDSTADDSGEGWLAEQARLVLLEDGS* |
Ga0137419_108276701 | 3300012925 | Vadose Zone Soil | EGGVTMDDDDATTYDPDPTGEDGGESWLAEQARLVLLEDGS* |
Ga0137416_101871623 | 3300012927 | Vadose Zone Soil | MDNDDVTVTNDEGEGPTEKGESWLAEQARLVLLEDGG* |
Ga0137416_103936112 | 3300012927 | Vadose Zone Soil | MDDDDAITYDNVDSTADDSGESWLAEQARLVLLEDGS* |
Ga0134078_102781702 | 3300014157 | Grasslands Soil | MDDDEGVMNYDDLDNDARGESWLAEQARLILLEDGS* |
Ga0137418_100335378 | 3300015241 | Vadose Zone Soil | SRREGGVTMDDDDATTYDVDSTADDSGEGWLAEQARLVLLEDGS* |
Ga0137418_101372183 | 3300015241 | Vadose Zone Soil | MDDDDATTYDPDPTGEDGGESWLAEQARLVLLEDGS* |
Ga0184605_102177942 | 3300018027 | Groundwater Sediment | MDDDDVTTYDEADNGSGDGAESWLAEQARLVLLEDGS |
Ga0184608_101389172 | 3300018028 | Groundwater Sediment | MDNDDVLISNDDADGSRDENGESWLAEQARLVLLEDG |
Ga0184619_100216602 | 3300018061 | Groundwater Sediment | MDNDEAPSTNDDVDRDSSHGESWLAEQARLVLLEDGS |
Ga0066669_101285472 | 3300018482 | Grasslands Soil | MDNDDVLISNDEADGSRDENGESWLAEQARLVLLEDGS |
Ga0066669_123667582 | 3300018482 | Grasslands Soil | VTVDDDENAITADADIDDGESWLAEQARLVLLEDGS |
Ga0193747_10015849 | 3300019885 | Soil | MTMDDDDTAGTYDEIDRGPEGAEESWLAEQARLVLLEDGS |
Ga0193755_11337481 | 3300020004 | Soil | MTMDDDETAGTYDEIDRGPEGAEESWLAEQARLVLLEDG |
Ga0193734_10488742 | 3300020015 | Soil | RQRRRSDMDNDDVLISNDEADGSRDENGESWLAEQARLVLLEDGS |
Ga0193721_10431043 | 3300020018 | Soil | MDNDDVPANNDKVDNDTGGESWLAEQARLILLEDGC |
Ga0193733_10426811 | 3300020022 | Soil | RGRSDMDNDDVLISNDEADGSRDENGESWLAEQARLVLLEDGS |
Ga0210382_104632661 | 3300021080 | Groundwater Sediment | MDDDETPGMSDDVERGPDDGQESWLAEQARLVLLEDGS |
Ga0193714_10031674 | 3300023058 | Soil | MDNDEGVTNNDELDNDAGGESWLAEQARLILLEDGS |
Ga0207653_101357702 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MDNDEGPITSDEVDRNIGDGETWLAEQARLVLLEDGS |
Ga0209238_10712272 | 3300026301 | Grasslands Soil | MTMDDHETAGTFDEVDRGPDQNQESWLAEQARLVLLEDGR |
Ga0209055_10567032 | 3300026309 | Soil | MDNDDVTTTNDDLYSRADDPGESWLAEQARLVLLEDGG |
Ga0209239_11552342 | 3300026310 | Grasslands Soil | MDTDEDAITYDNVDSTADNSAESWLAEQARLVLLEDGS |
Ga0209239_11827652 | 3300026310 | Grasslands Soil | MDDDDATTANDDVELNSGDAESWLAEQARLVLLEDGS |
Ga0209154_10032495 | 3300026317 | Soil | MDNDDVTTTNDDLYSRADDPGESWLAEQARLVLLEDG |
Ga0209801_11587763 | 3300026326 | Soil | RREGGLTMDNDDVTTTNDDLYSGADDPGESWLAEQARLVLLEDGG |
Ga0209266_12645302 | 3300026327 | Soil | MDDDQAASTNDEGDRNTGEGESWLAEQARLVLLEDGS |
Ga0209802_10964562 | 3300026328 | Soil | MDDDEGAITYDGTDRGPEDRAESWLAEQARLLLLEDGG |
Ga0209806_10086179 | 3300026529 | Soil | MDNDDVTTTNDDLYSGADDPGESWLAEQARLVLLEDGG |
Ga0209076_11838861 | 3300027643 | Vadose Zone Soil | MDNDDVTVTNDEGEGPTEKGESWLAEQARLVLLEDGG |
Ga0209689_10179592 | 3300027748 | Soil | MDNDDVTTTNDDQYSEAEDPGESWLAEQARLVLLEDG |
Ga0209283_100338215 | 3300027875 | Vadose Zone Soil | MDIDEPATTNDEAVGITGDGESWLAEQARLVLLEDGS |
Ga0209590_102818212 | 3300027882 | Vadose Zone Soil | VTVDDDEAAITDEDADRGSDDRGESWLAEQARLVLLEDGS |
Ga0209590_108016032 | 3300027882 | Vadose Zone Soil | MMDNDGAAATYDEVDRDPDSGAEESWLAEQARLVLLEDGN |
Ga0137415_107725232 | 3300028536 | Vadose Zone Soil | MDDDDAITYDNVDSTADDSGESWLAEQARLVLLEDGS |
Ga0307293_100553782 | 3300028711 | Soil | MDNDNDDVTTYETDSASGDGAESWLAEQARLVLLEDGS |
Ga0307313_100555363 | 3300028715 | Soil | MDNDDDVTTYETDSASGDGAESWLAEQARLVLLEDGS |
Ga0307288_103136891 | 3300028778 | Soil | MDNDNDDVTTYETDSASGDGAESWLAEQARLVLLED |
Ga0307282_104610822 | 3300028784 | Soil | MDDNETSTTNNEGDPDTGKSESWLAEQARLVLLEDGS |
Ga0307282_104850662 | 3300028784 | Soil | RQRRRSEMDDNETSTTNNGGDPDTGRSESWLAEQARLILLEDGC |
Ga0307310_101007993 | 3300028824 | Soil | VTMDNDNDDVTTYETDSASGDGAESWLAEQARLVLLEDGS |
Ga0307278_102517323 | 3300028878 | Soil | MDQEDVLINNNEMDGENNTESWLAEQARLVLLEDGG |
Ga0307277_100230025 | 3300028881 | Soil | VTVDNDDVLISNDEIDARSDDNAESWLAEQARLVLLEDGG |
Ga0307277_102622872 | 3300028881 | Soil | MDGDDVLISNDEVDSSDDNNESWLAEQARLVLLEDGG |
Ga0307277_102791562 | 3300028881 | Soil | MDNDDATTANDDVELNAGDGESWLAEQARLILLEDGG |
Ga0307308_100021242 | 3300028884 | Soil | MDYDDATTANDDLEPNAGDGESWLAEQARLILLEDGG |
Ga0308189_101066062 | 3300031058 | Soil | MDNDEGVTNNDELDNDVGGEGWLAEQARLILLEDGS |
Ga0307471_1018625692 | 3300032180 | Hardwood Forest Soil | MDDDEGVAKYDDIDGDEGGESWLAEQARLILVEDGG |
Ga0307471_1032633832 | 3300032180 | Hardwood Forest Soil | MDDDETATTNDEDAGRPRDGESWLAEQARLVLLEDGS |
Ga0307471_1033355842 | 3300032180 | Hardwood Forest Soil | VTMDNDDVTVTNDEGEAPTDKGESWLAEQARLVLLEDGS |
Ga0370548_124685_3_113 | 3300034644 | Soil | MDNDDVLISNDEADGSRDENGESWLAEQARLVLLEDG |
⦗Top⦘ |