Basic Information | |
---|---|
Family ID | F104270 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 42 residues |
Representative Sequence | HKDLDRFGPPERNTLRPVWWFVFPLVLFDVLEGSLLALI |
Number of Associated Samples | 65 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 26.00 % |
% of genes near scaffold ends (potentially truncated) | 98.00 % |
% of genes from short scaffolds (< 2000 bps) | 96.00 % |
Associated GOLD sequencing projects | 65 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (77.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (82.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (97.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (78.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF00078 | RVT_1 | 1.00 |
PF04195 | Transposase_28 | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 77.00 % |
All Organisms | root | All Organisms | 23.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005617|Ga0068859_101123728 | Not Available | 865 | Open in IMG/M |
3300009553|Ga0105249_11830940 | Not Available | 680 | Open in IMG/M |
3300009975|Ga0105129_105852 | Not Available | 732 | Open in IMG/M |
3300009976|Ga0105128_114892 | Not Available | 574 | Open in IMG/M |
3300009980|Ga0105135_105429 | Not Available | 845 | Open in IMG/M |
3300009980|Ga0105135_111219 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 694 | Open in IMG/M |
3300009980|Ga0105135_125082 | Not Available | 543 | Open in IMG/M |
3300009981|Ga0105133_118139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei | 603 | Open in IMG/M |
3300009989|Ga0105131_109468 | Not Available | 818 | Open in IMG/M |
3300009989|Ga0105131_142280 | Not Available | 511 | Open in IMG/M |
3300009990|Ga0105132_121661 | Not Available | 639 | Open in IMG/M |
3300009994|Ga0105126_1012478 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 834 | Open in IMG/M |
3300009995|Ga0105139_1074984 | Not Available | 632 | Open in IMG/M |
3300009995|Ga0105139_1115560 | Not Available | 520 | Open in IMG/M |
3300010396|Ga0134126_12967389 | Not Available | 513 | Open in IMG/M |
3300015290|Ga0182105_1059647 | Not Available | 621 | Open in IMG/M |
3300015297|Ga0182104_1008530 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1162 | Open in IMG/M |
3300015297|Ga0182104_1112997 | Not Available | 515 | Open in IMG/M |
3300015301|Ga0182184_1061328 | Not Available | 598 | Open in IMG/M |
3300015301|Ga0182184_1086215 | Not Available | 532 | Open in IMG/M |
3300015306|Ga0182180_1021852 | Not Available | 855 | Open in IMG/M |
3300015306|Ga0182180_1022392 | Not Available | 847 | Open in IMG/M |
3300015310|Ga0182162_1059290 | Not Available | 671 | Open in IMG/M |
3300015311|Ga0182182_1057702 | Not Available | 658 | Open in IMG/M |
3300015311|Ga0182182_1075057 | Not Available | 601 | Open in IMG/M |
3300015311|Ga0182182_1089081 | Not Available | 565 | Open in IMG/M |
3300015316|Ga0182121_1005395 | Not Available | 1511 | Open in IMG/M |
3300015317|Ga0182136_1062107 | Not Available | 686 | Open in IMG/M |
3300015317|Ga0182136_1126630 | Not Available | 525 | Open in IMG/M |
3300015317|Ga0182136_1134504 | Not Available | 512 | Open in IMG/M |
3300015320|Ga0182165_1075140 | Not Available | 655 | Open in IMG/M |
3300015327|Ga0182114_1134269 | Not Available | 545 | Open in IMG/M |
3300015328|Ga0182153_1061532 | Not Available | 709 | Open in IMG/M |
3300015328|Ga0182153_1066978 | Not Available | 688 | Open in IMG/M |
3300015329|Ga0182135_1119110 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 559 | Open in IMG/M |
3300015330|Ga0182152_1073509 | Not Available | 673 | Open in IMG/M |
3300015332|Ga0182117_1040140 | Not Available | 890 | Open in IMG/M |
3300015333|Ga0182147_1064082 | Not Available | 741 | Open in IMG/M |
3300015333|Ga0182147_1098746 | Not Available | 629 | Open in IMG/M |
3300015334|Ga0182132_1116051 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 590 | Open in IMG/M |
3300015335|Ga0182116_1176625 | Not Available | 504 | Open in IMG/M |
3300015336|Ga0182150_1066778 | Not Available | 718 | Open in IMG/M |
3300015337|Ga0182151_1017291 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1116 | Open in IMG/M |
3300015337|Ga0182151_1076239 | Not Available | 684 | Open in IMG/M |
3300015337|Ga0182151_1076988 | Not Available | 682 | Open in IMG/M |
3300015338|Ga0182137_1151624 | Not Available | 541 | Open in IMG/M |
3300015339|Ga0182149_1076755 | Not Available | 702 | Open in IMG/M |
3300015339|Ga0182149_1153765 | Not Available | 530 | Open in IMG/M |
3300015340|Ga0182133_1091121 | Not Available | 690 | Open in IMG/M |
3300015340|Ga0182133_1168165 | Not Available | 533 | Open in IMG/M |
3300015348|Ga0182115_1114275 | Not Available | 854 | Open in IMG/M |
3300015348|Ga0182115_1153589 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 737 | Open in IMG/M |
3300015348|Ga0182115_1289782 | Not Available | 517 | Open in IMG/M |
3300015349|Ga0182185_1135547 | Not Available | 727 | Open in IMG/M |
3300015349|Ga0182185_1152108 | Not Available | 689 | Open in IMG/M |
3300015349|Ga0182185_1172875 | Not Available | 648 | Open in IMG/M |
3300015349|Ga0182185_1270602 | Not Available | 518 | Open in IMG/M |
3300015350|Ga0182163_1035079 | Not Available | 1344 | Open in IMG/M |
3300015352|Ga0182169_1127860 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria | 824 | Open in IMG/M |
3300015352|Ga0182169_1187179 | Not Available | 677 | Open in IMG/M |
3300015353|Ga0182179_1221917 | Not Available | 605 | Open in IMG/M |
3300015353|Ga0182179_1314586 | Not Available | 510 | Open in IMG/M |
3300015354|Ga0182167_1128473 | Not Available | 934 | Open in IMG/M |
3300015354|Ga0182167_1245816 | Not Available | 646 | Open in IMG/M |
3300015354|Ga0182167_1252015 | Not Available | 636 | Open in IMG/M |
3300015354|Ga0182167_1325106 | Not Available | 541 | Open in IMG/M |
3300017408|Ga0182197_1116094 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis | 557 | Open in IMG/M |
3300017412|Ga0182199_1083758 | Not Available | 711 | Open in IMG/M |
3300017412|Ga0182199_1102873 | Not Available | 659 | Open in IMG/M |
3300017422|Ga0182201_1067831 | Not Available | 653 | Open in IMG/M |
3300017422|Ga0182201_1069971 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 647 | Open in IMG/M |
3300017432|Ga0182196_1062077 | Not Available | 692 | Open in IMG/M |
3300017439|Ga0182200_1067608 | Not Available | 686 | Open in IMG/M |
3300017445|Ga0182198_1056012 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 814 | Open in IMG/M |
3300017445|Ga0182198_1080644 | Not Available | 716 | Open in IMG/M |
3300017445|Ga0182198_1154451 | Not Available | 561 | Open in IMG/M |
3300017693|Ga0182216_1189658 | Not Available | 538 | Open in IMG/M |
3300017693|Ga0182216_1195943 | Not Available | 531 | Open in IMG/M |
3300028058|Ga0268332_1036724 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 666 | Open in IMG/M |
3300028061|Ga0268314_1040321 | Not Available | 561 | Open in IMG/M |
3300028262|Ga0268310_1009205 | Not Available | 877 | Open in IMG/M |
3300032490|Ga0214495_1058112 | Not Available | 902 | Open in IMG/M |
3300032502|Ga0214490_1115398 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 612 | Open in IMG/M |
3300032514|Ga0214502_1004792 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 3485 | Open in IMG/M |
3300032514|Ga0214502_1060412 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 1393 | Open in IMG/M |
3300032551|Ga0321339_1092121 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 693 | Open in IMG/M |
3300032590|Ga0214489_1003246 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1873 | Open in IMG/M |
3300032590|Ga0214489_1024475 | Not Available | 896 | Open in IMG/M |
3300032758|Ga0314746_1029862 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1214 | Open in IMG/M |
3300032790|Ga0314731_1007903 | Not Available | 1537 | Open in IMG/M |
3300032845|Ga0314727_1017703 | Not Available | 983 | Open in IMG/M |
3300032845|Ga0314727_1038211 | Not Available | 664 | Open in IMG/M |
3300032890|Ga0314747_1025461 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 896 | Open in IMG/M |
3300032914|Ga0314750_1104741 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 659 | Open in IMG/M |
3300032934|Ga0314741_1101867 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 662 | Open in IMG/M |
3300032959|Ga0314738_1000970 | Not Available | 2984 | Open in IMG/M |
3300033525|Ga0314758_1179459 | Not Available | 576 | Open in IMG/M |
3300033526|Ga0314761_1000140 | Not Available | 5503 | Open in IMG/M |
3300033530|Ga0314760_1007067 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 2232 | Open in IMG/M |
3300033532|Ga0314767_1051839 | Not Available | 998 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 82.00% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 12.00% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 3.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300032490 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032590 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032758 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032790 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032845 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032890 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032914 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032959 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033525 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033526 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033532 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068859_1011237283 | 3300005617 | Switchgrass Rhizosphere | RFGPPERNTLRPMWWFVFPLVLFDVLEGSLFALI* |
Ga0105249_118309401 | 3300009553 | Switchgrass Rhizosphere | LAEIRTRWCKEHKDLDRFGPPERNTLHPVWWFVFPQVLFDVLERSLLALI* |
Ga0105129_1058521 | 3300009975 | Switchgrass Associated | MRWCQEHKDLDRFRPPERNTLRPVCWFVFPLVLFDLLEGSLLALI |
Ga0105128_1148921 | 3300009976 | Switchgrass Associated | KEHKDLDRFRPLERNTLRSVWWFVFPQVLFDVLEGSLFALI* |
Ga0105135_1054291 | 3300009980 | Switchgrass Associated | EHKDLDRFGPPERNTIRPMWWFVFPLVLFDVLEGSLLALI* |
Ga0105135_1112192 | 3300009980 | Switchgrass Associated | MIVGKGSTTSGTRWCKEHKDLDRFRPPERNTLRPVWWFVFPQVLFDILEGSLPALI |
Ga0105135_1250821 | 3300009980 | Switchgrass Associated | AEIRTRWCKEHKDLDRFGPPEYNTLHPVWWFVFPLALFDVFEGSLLALI* |
Ga0105133_1181391 | 3300009981 | Switchgrass Associated | HMDLDRFGPPERNTLRPVWWFVFPLVLFDVLEGSMFAFI* |
Ga0105131_1094681 | 3300009989 | Switchgrass Associated | HKDLDRFGPPERNTLPHVWWFVFPLVLFDVLEGSLFALI* |
Ga0105131_1422801 | 3300009989 | Switchgrass Associated | YKEHKDLDRFGPPERNTLRPMWWFVFPLVLFDILEVSLRALI* |
Ga0105132_1216611 | 3300009990 | Switchgrass Associated | DLDRFGPPEGNTLRPVWWFVFPLVLFDVLEGFLFALI* |
Ga0105126_10124781 | 3300009994 | Switchgrass Associated | LAEIRTQWCKEHKDLDRFRPPERNTLRPVWWFVFPQILFDVLEGPLVALI* |
Ga0105139_10749842 | 3300009995 | Switchgrass Associated | CKEHKYLDRFGPPERNTLRHVWWFVFPLILFDVLEGSLFALV* |
Ga0105139_11155601 | 3300009995 | Switchgrass Associated | MRWCKEHKDLDKFGSPERNTLHPVWWFVFPQVLSPILEGSL |
Ga0134126_129673891 | 3300010396 | Terrestrial Soil | WCKKHKDLDRFGLPERNTLRSVWWFVFPLVLSNVLEGSLLALI* |
Ga0182105_10596471 | 3300015290 | Switchgrass Phyllosphere | HKDLDRFGPPERNTLRHVWWFVFPLILFDVLEGSLFALV* |
Ga0182104_10085301 | 3300015297 | Switchgrass Phyllosphere | KHKNLDRFGPPERNTLCPVWLFVFPLVLFDVLEGSLFALI* |
Ga0182104_11129971 | 3300015297 | Switchgrass Phyllosphere | RLGPPERNTLRPVWWFVFPQVLFDVLEGSLLTLI* |
Ga0182184_10613281 | 3300015301 | Switchgrass Phyllosphere | HKNLDRFGPPERNTLRPVWWFVFPLVLFDILEGSLLALI* |
Ga0182184_10862152 | 3300015301 | Switchgrass Phyllosphere | EHKDLDRFGPPERNTLRPVWWFVFPLVLSDVLEGPLLALI* |
Ga0182180_10218521 | 3300015306 | Switchgrass Phyllosphere | EHKDLDRFGPPEHNTLRLVWWFVVPLVLFDLLEGPLFALI* |
Ga0182180_10223922 | 3300015306 | Switchgrass Phyllosphere | WCKEHKDLDRFGLPERNTLRPVWWFVFPLVLFDVLEGSLFALI* |
Ga0182162_10592901 | 3300015310 | Switchgrass Phyllosphere | MRWCKEHKDLNRFGPPERNTLRPVWWFVFPHILFDVLEGSLRALIYLGGAG |
Ga0182182_10577021 | 3300015311 | Switchgrass Phyllosphere | MRWCTEHKDLDRFGPSERNTLRPVWWFVFPLVLFDLLEGPLFAL |
Ga0182182_10750571 | 3300015311 | Switchgrass Phyllosphere | MRWCKKHNDLDRFRPPERNTLRPVWWFVFPLILFDVLEGSL |
Ga0182182_10890811 | 3300015311 | Switchgrass Phyllosphere | HKDLDRFRPPQLNTLHPVWWFVFPLVLFDVLEGSLSALI* |
Ga0182121_10053951 | 3300015316 | Switchgrass Phyllosphere | GLAEIRTRWCKEHKDLDRFGPPKRNTLYSVWWFVFHLVLFDVLEGFLLTLI* |
Ga0182136_10621071 | 3300015317 | Switchgrass Phyllosphere | LAEIRTRWCKEHKDLDRFGPPERNTLRPVCWFVFPLVLFDVLEGSLFALI* |
Ga0182136_11266301 | 3300015317 | Switchgrass Phyllosphere | RFRPPERNTLRPVWCFVFPLVLFDVLEGSLFALI* |
Ga0182136_11345041 | 3300015317 | Switchgrass Phyllosphere | HKDLDRFGPPEHNTLRPVWWFVFPLVLFDLLEGPLFALI* |
Ga0182165_10751402 | 3300015320 | Switchgrass Phyllosphere | DLDRFGPPERNTLRPMWLFVFPLVLFDVLEGSLSALI* |
Ga0182114_11342691 | 3300015327 | Switchgrass Phyllosphere | MRWCKEHKDLDRFRPPERNSLRPMWWFVFPQVLFDLLEGS |
Ga0182153_10615321 | 3300015328 | Switchgrass Phyllosphere | KFRPPDRNTLRPMWCFVFPLVLFDVLEGPLVALI* |
Ga0182153_10669781 | 3300015328 | Switchgrass Phyllosphere | HKDLDRFGPPERNTLRPVWWFVFPLVLFDVLEGSLLALI* |
Ga0182135_11191101 | 3300015329 | Switchgrass Phyllosphere | MRWYKEHKDLDRLGLPEHNTLRPVWWFVFPQVFFDVLEGSLF |
Ga0182152_10735091 | 3300015330 | Switchgrass Phyllosphere | MGTRWCKEHKDLDTYGPPECNTLHPMWWFVSPLVLFDLLEGPLFAL |
Ga0182117_10401402 | 3300015332 | Switchgrass Phyllosphere | KEHKDLDRFRPPECNTLCPLWWFVFPQVLFDVLEGSLFSLI* |
Ga0182147_10640821 | 3300015333 | Switchgrass Phyllosphere | DLDRFGPPERNTLRLVWWFVFPLVLFDVLEGFLLALL* |
Ga0182147_10987461 | 3300015333 | Switchgrass Phyllosphere | RFEPPERNTLRPVWWFVSSLVLFDILEGSLTALI* |
Ga0182132_11160512 | 3300015334 | Switchgrass Phyllosphere | WCKEHKDLDRFGPPERNTLRPVCWFVFPLVLFDVLEGSLFALI* |
Ga0182116_11766251 | 3300015335 | Switchgrass Phyllosphere | MCCSGCKEHKDLDRFGPPERNTLRSVWWFVFPLVLFDVLEGPCS |
Ga0182150_10667781 | 3300015336 | Switchgrass Phyllosphere | MVQGTQGFRQFGPPERNTLRPVWWFVFPLVLFDVLEGSLSALIYLGG |
Ga0182151_10172911 | 3300015337 | Switchgrass Phyllosphere | DLDRFRQPERNTLRPVWWFVFPQVLFDILEGYLFALI* |
Ga0182151_10762391 | 3300015337 | Switchgrass Phyllosphere | MRWCREHKDLDRFGTPERNTLRPVWWFVFPQVLFDGLEGSLFALI |
Ga0182151_10769881 | 3300015337 | Switchgrass Phyllosphere | KEHKDLDRFGPPERNTLRHVWWFVFPLVLFDVLEGSPSALI* |
Ga0182137_11516242 | 3300015338 | Switchgrass Phyllosphere | MVQATQGLGRFRPQMLRNTLRPMWWFVFPLVLFDVL |
Ga0182149_10767551 | 3300015339 | Switchgrass Phyllosphere | KKHKDLDRFGPPERNTLRPVWLFVFPLVLFDVLEGSLFDLI* |
Ga0182149_11537651 | 3300015339 | Switchgrass Phyllosphere | GLAEIRMRWCKEHKGLDSFGPPERNTLRHVWWFVFPLILFDVLEGSLFALV* |
Ga0182133_10911211 | 3300015340 | Switchgrass Phyllosphere | CKEHKDLDRFRPPKRNTLRPVWWFVFPLVLFDVLKGSLFALI* |
Ga0182133_11681652 | 3300015340 | Switchgrass Phyllosphere | MRWCKEHKNLDRFRPPERNTLRPVWWFVFPLVLFHDLEGSLLA |
Ga0182115_11142751 | 3300015348 | Switchgrass Phyllosphere | EIRTRWCKEHKDLDRFGLPERNTLCPVWWFVFPLVLFDLLEGSLLALI* |
Ga0182115_11535891 | 3300015348 | Switchgrass Phyllosphere | DRFGPPERNTLRPVWLFVFPLVLFDILEGSLFALI* |
Ga0182115_12897821 | 3300015348 | Switchgrass Phyllosphere | DRFRPLEPNTLRPVWRFVFPQVLFDVLEGSLFALI* |
Ga0182185_11355471 | 3300015349 | Switchgrass Phyllosphere | KMRWCKEHKDLDRFGPPERNTIRPVWWLVFPLVLFDLLEGPLFALI* |
Ga0182185_11521083 | 3300015349 | Switchgrass Phyllosphere | MRWCTEHKDLDRFGPPERNTLRPVWWFVFPLVLFDLLEGSLF |
Ga0182185_11728751 | 3300015349 | Switchgrass Phyllosphere | MRWCKEHKDLDKFRPPDRNTLRPMWCFVFSLVLFDV |
Ga0182185_12706021 | 3300015349 | Switchgrass Phyllosphere | HKDLDRFGPPERNTLCLVWWFVFPLVLFDVLEGSLFALI* |
Ga0182163_10350791 | 3300015350 | Switchgrass Phyllosphere | MRWCKEHKDLDRFGPLERNTLRPVWWFIFPQVLFDVLEGSLL |
Ga0182169_11278601 | 3300015352 | Switchgrass Phyllosphere | HKDLDRFGPPEHNTLRPVWCFVFPLVLFDVLEGSLLALI* |
Ga0182169_11871791 | 3300015352 | Switchgrass Phyllosphere | KEHKDLDRFGPPERNTLRYVWWFVFPLVFFDLLEGSLLTLI* |
Ga0182179_12219171 | 3300015353 | Switchgrass Phyllosphere | KEHKDLDKFGPPERNILRPVWWFVFSLVLFDILEGSLLTLI* |
Ga0182179_13145861 | 3300015353 | Switchgrass Phyllosphere | IRMRWCKEHKDLDRFGPPERNTLCPVWWFVFPLVLFDVLEGSLLALI* |
Ga0182167_11284732 | 3300015354 | Switchgrass Phyllosphere | CKEHKDLDRFGPPERNTLRPVWWFVFPLVLFDRLEGSLFALI* |
Ga0182167_12458161 | 3300015354 | Switchgrass Phyllosphere | KDLDRFGPSERNTLRPVWWFVFPLVLFDVLEGSLFALI* |
Ga0182167_12520152 | 3300015354 | Switchgrass Phyllosphere | RFRPPERNTLHTVWWFVFPLVLFDVLEGSLLALI* |
Ga0182167_13251062 | 3300015354 | Switchgrass Phyllosphere | KEHKDLDRFGPPERNTLRPVCWFVFPLVLFDVLEGSLPTLI* |
Ga0182197_11160941 | 3300017408 | Switchgrass Phyllosphere | MQWCKEHKDLDRFRPPECNTLRPVWWFVFPLVLFDVLEGSL |
Ga0182199_10837581 | 3300017412 | Switchgrass Phyllosphere | KEHKDLDRFKPPECNILRPVWWFVFPQVLFDGLEGSLFALI |
Ga0182199_11028731 | 3300017412 | Switchgrass Phyllosphere | CKEHKDLDRFRPPERNTLRPVWWFVFPLVLFVVLEVSLLTLI |
Ga0182201_10678311 | 3300017422 | Switchgrass Phyllosphere | KDLDRFGPPERNTLHPVWWFVFPLVLVDVFEGSLPALI |
Ga0182201_10699711 | 3300017422 | Switchgrass Phyllosphere | DRFRPPERNTLRPVWWFVFALVLFDVSERSLLVLI |
Ga0182196_10620771 | 3300017432 | Switchgrass Phyllosphere | LAEIRTRWCKEHKDLDRFRPLERNTLRPVWWFVFPQVLFDVLEGSLFALI |
Ga0182200_10676081 | 3300017439 | Switchgrass Phyllosphere | KEHKDLDMFMPPEHNTLRPVWWFVFPMVLFDVLKGSLFALI |
Ga0182198_10560121 | 3300017445 | Switchgrass Phyllosphere | MRWGKEHKDLDRFRPPQLNTLHPVWWFVFPLVLFDVL |
Ga0182198_10806442 | 3300017445 | Switchgrass Phyllosphere | HKDLDRFGPPECNTLHLVCWFVFPLVLFDLLEGSLLALI |
Ga0182198_11544511 | 3300017445 | Switchgrass Phyllosphere | DLDRFRPPERNTLRPVWLFVFPQILFDVLVGSLLAIL |
Ga0182216_11896581 | 3300017693 | Switchgrass Phyllosphere | EMRTRLCKEHKDLDRFGLSEGNTLRPVWWFVFPLVLFHDLEGSLLALI |
Ga0182216_11959431 | 3300017693 | Switchgrass Phyllosphere | DRFRPPERNTLRPVWWFVFPLVLFDVLEESLFALI |
Ga0268332_10367241 | 3300028058 | Phyllosphere | GRAEIITRWSKEHKDLDSFGPPECNTLRPVWWFVFPLVLFDLLEGSLLALI |
Ga0268314_10403211 | 3300028061 | Phyllosphere | RMRWCKEHKDLDRFGPPERNNLRPVWWFVFPLVLFDALEGSLFALI |
Ga0268310_10092052 | 3300028262 | Phyllosphere | DLDRFGPPERNTIRHVWWFVFPLVLFDVLEGSLLALI |
Ga0214495_10581121 | 3300032490 | Switchgrass Phyllosphere | WCKEHKDLDRFGPPERNTLRPVCWFVFPLVLFDLLEGFPFALI |
Ga0214490_11153982 | 3300032502 | Switchgrass Phyllosphere | CKEHKDLDRFGPPERNTLRPVWWFVFALVLFDVLEGS |
Ga0214502_10047925 | 3300032514 | Switchgrass Phyllosphere | MRWCKEHKDLDRFGPLERNTLRPVWWFVFPLVLFDVLEGSLLALI |
Ga0214502_10604121 | 3300032514 | Switchgrass Phyllosphere | EIRTRWCKEHKDLDRFGPPERNTLRPVWWFVFPLILFDVLEGSLLALI |
Ga0321339_10921212 | 3300032551 | Switchgrass Phyllosphere | MRWCKEHKDLDRFRPPERNSLRPMWWFVFPQVLFDLLEGSLSA |
Ga0214489_10032465 | 3300032590 | Switchgrass Phyllosphere | MRWCKEHKDLDRFGPPERNTLRPVCWFVFPLVLFDLLEGFP |
Ga0214489_10244751 | 3300032590 | Switchgrass Phyllosphere | DLDRFGPPERNTLRPVCWFVFPLVLFDLLEGFPFALI |
Ga0314746_10298621 | 3300032758 | Switchgrass Phyllosphere | HKDLDRFRPPEHNTLRPVWWFVFPLVLFDVLKGSLFGLI |
Ga0314731_10079031 | 3300032790 | Switchgrass Phyllosphere | MRWCKEHKDLDRFGPSERNTLRHMWWFVFPLDLFDILEGSL |
Ga0314727_10177031 | 3300032845 | Switchgrass Phyllosphere | EIRTRWCKEHNDLDRFGPPEGNTLRLVWWFVFPLVLFDVLEGFLFALI |
Ga0314727_10382111 | 3300032845 | Switchgrass Phyllosphere | MRWCKEHKDLDRFGPPERNILRPVWWFVFSLVLFDVLEES |
Ga0314747_10254611 | 3300032890 | Switchgrass Phyllosphere | VIRTRWCKEHKDLDRFGPPERNTLRPVWWFVFPLILFDVLEGSLF |
Ga0314750_11047412 | 3300032914 | Switchgrass Phyllosphere | HKDLDRFGPPERNTLRPMWWFVFPLVLFDVLEGSLFALI |
Ga0314741_11018672 | 3300032934 | Switchgrass Phyllosphere | GTQELDRFGPPERNTLRPVWWFVFPLVLFDVLEGSMLALI |
Ga0314738_10009703 | 3300032959 | Switchgrass Phyllosphere | MVQGTQELDRFGPPERNTLRPVWWFVFPLVLFDVLEGSLLALI |
Ga0314758_11794591 | 3300033525 | Switchgrass Phyllosphere | TRWCKEHMDLDRFGPPERNTLRPVWWFVFPLVLFDVLEGSLFALI |
Ga0314761_10001401 | 3300033526 | Switchgrass Phyllosphere | MCKEHKDLDRFGPPERNTLRPVWWFVFPLVLFDDLEGSLFALSL |
Ga0314760_10070674 | 3300033530 | Switchgrass Phyllosphere | CKEHKDLNRFGPLERNTLRPVWWFVFPLVLFDVLEGSLLALI |
Ga0314767_10518392 | 3300033532 | Switchgrass Phyllosphere | EIRTRWCKEHKDLDRFRPPEHNTLRPVWWFVFPLVLFDVLKGSLFGLI |
⦗Top⦘ |