Basic Information | |
---|---|
Family ID | F104002 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 101 |
Average Sequence Length | 42 residues |
Representative Sequence | LARLKWEQAKHAAASGAATWRDHPNAKVRLARRTSSG |
Number of Associated Samples | 86 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.01 % |
% of genes from short scaffolds (< 2000 bps) | 96.04 % |
Associated GOLD sequencing projects | 83 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (67.327 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.752 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.762 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.485 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.77% β-sheet: 0.00% Coil/Unstructured: 69.23% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF00903 | Glyoxalase | 17.82 |
PF16884 | ADH_N_2 | 11.88 |
PF00072 | Response_reg | 6.93 |
PF00313 | CSD | 6.93 |
PF00486 | Trans_reg_C | 5.94 |
PF07077 | DUF1345 | 3.96 |
PF13472 | Lipase_GDSL_2 | 2.97 |
PF00069 | Pkinase | 1.98 |
PF14864 | Alkyl_sulf_C | 0.99 |
PF01047 | MarR | 0.99 |
PF08530 | PepX_C | 0.99 |
PF02467 | Whib | 0.99 |
PF03880 | DbpA | 0.99 |
PF02518 | HATPase_c | 0.99 |
PF00465 | Fe-ADH | 0.99 |
PF12681 | Glyoxalase_2 | 0.99 |
PF03706 | LPG_synthase_TM | 0.99 |
PF01757 | Acyl_transf_3 | 0.99 |
PF03631 | Virul_fac_BrkB | 0.99 |
PF00378 | ECH_1 | 0.99 |
PF01636 | APH | 0.99 |
PF02156 | Glyco_hydro_26 | 0.99 |
PF00501 | AMP-binding | 0.99 |
PF00106 | adh_short | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 7.92 |
COG4291 | Uncharacterized membrane protein | Function unknown [S] | 3.96 |
COG0513 | Superfamily II DNA and RNA helicase | Replication, recombination and repair [L] | 2.97 |
COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.99 |
COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.99 |
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.99 |
COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.99 |
COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.99 |
COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.99 |
COG4124 | Beta-mannanase | Carbohydrate transport and metabolism [G] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 67.33 % |
Unclassified | root | N/A | 32.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001634|JGI20245J16306_1007611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
3300004082|Ga0062384_101120853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
3300004092|Ga0062389_102592917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 674 | Open in IMG/M |
3300004977|Ga0072329_1396749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 549 | Open in IMG/M |
3300005921|Ga0070766_10738603 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 668 | Open in IMG/M |
3300005921|Ga0070766_11089288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 551 | Open in IMG/M |
3300006162|Ga0075030_101097699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 626 | Open in IMG/M |
3300009520|Ga0116214_1231276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Humibacillus → unclassified Humibacillus → Humibacillus sp. DSM 29435 | 700 | Open in IMG/M |
3300009522|Ga0116218_1376500 | Not Available | 634 | Open in IMG/M |
3300009523|Ga0116221_1411897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Humibacillus → unclassified Humibacillus → Humibacillus sp. DSM 29435 | 588 | Open in IMG/M |
3300009623|Ga0116133_1006429 | Not Available | 2945 | Open in IMG/M |
3300009698|Ga0116216_10658804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium stomatepiae | 630 | Open in IMG/M |
3300009700|Ga0116217_10478109 | Not Available | 784 | Open in IMG/M |
3300009700|Ga0116217_10478235 | Not Available | 784 | Open in IMG/M |
3300009700|Ga0116217_10634841 | Not Available | 663 | Open in IMG/M |
3300010379|Ga0136449_101625907 | Not Available | 979 | Open in IMG/M |
3300010880|Ga0126350_10999378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
3300010937|Ga0137776_1361276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1084 | Open in IMG/M |
3300011075|Ga0138555_1151651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium stomatepiae | 514 | Open in IMG/M |
3300011411|Ga0153933_1083475 | Not Available | 677 | Open in IMG/M |
3300014201|Ga0181537_10368510 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 986 | Open in IMG/M |
3300014654|Ga0181525_10174446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1176 | Open in IMG/M |
3300014657|Ga0181522_10152517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1351 | Open in IMG/M |
3300016341|Ga0182035_12084298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus albus | 515 | Open in IMG/M |
3300017822|Ga0187802_10274890 | Not Available | 654 | Open in IMG/M |
3300017924|Ga0187820_1042018 | Not Available | 1216 | Open in IMG/M |
3300017928|Ga0187806_1245766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Humibacillus → unclassified Humibacillus → Humibacillus sp. DSM 29435 | 618 | Open in IMG/M |
3300017948|Ga0187847_10259629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
3300018001|Ga0187815_10293731 | Not Available | 689 | Open in IMG/M |
3300018009|Ga0187884_10162586 | Not Available | 935 | Open in IMG/M |
3300018042|Ga0187871_10179900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1186 | Open in IMG/M |
3300018046|Ga0187851_10088966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1934 | Open in IMG/M |
3300018046|Ga0187851_10128869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1548 | Open in IMG/M |
3300018062|Ga0187784_10920382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 696 | Open in IMG/M |
3300018062|Ga0187784_11337181 | Not Available | 568 | Open in IMG/M |
3300020078|Ga0206352_10574492 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
3300020581|Ga0210399_10446595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1077 | Open in IMG/M |
3300020582|Ga0210395_10156900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1699 | Open in IMG/M |
3300020583|Ga0210401_10771901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 821 | Open in IMG/M |
3300021171|Ga0210405_11418620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Humibacillus → unclassified Humibacillus → Humibacillus sp. DSM 29435 | 505 | Open in IMG/M |
3300021405|Ga0210387_10095734 | All Organisms → cellular organisms → Bacteria | 2475 | Open in IMG/M |
3300021433|Ga0210391_10493142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 962 | Open in IMG/M |
3300022522|Ga0242659_1082014 | Not Available | 615 | Open in IMG/M |
3300022527|Ga0242664_1017850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus | 1084 | Open in IMG/M |
3300022530|Ga0242658_1163394 | Not Available | 583 | Open in IMG/M |
3300022711|Ga0242674_1026871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
3300022713|Ga0242677_1028441 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 734 | Open in IMG/M |
3300022715|Ga0242678_1048439 | Not Available | 608 | Open in IMG/M |
3300022721|Ga0242666_1160341 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 556 | Open in IMG/M |
3300022722|Ga0242657_1151425 | Not Available | 611 | Open in IMG/M |
3300024227|Ga0228598_1102848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes lobatus | 577 | Open in IMG/M |
3300025527|Ga0208714_1027680 | Not Available | 1338 | Open in IMG/M |
3300026467|Ga0257154_1056575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Humibacillus → unclassified Humibacillus → Humibacillus sp. DSM 29435 | 612 | Open in IMG/M |
3300027652|Ga0209007_1056248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 997 | Open in IMG/M |
3300027824|Ga0209040_10251205 | Not Available | 887 | Open in IMG/M |
3300027905|Ga0209415_10447352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1019 | Open in IMG/M |
3300027908|Ga0209006_10284687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1414 | Open in IMG/M |
3300027911|Ga0209698_10411682 | Not Available | 1055 | Open in IMG/M |
3300027911|Ga0209698_11213506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Humibacillus → unclassified Humibacillus → Humibacillus sp. DSM 29435 | 555 | Open in IMG/M |
3300028863|Ga0302218_10067493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1120 | Open in IMG/M |
3300028877|Ga0302235_10190495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
3300028879|Ga0302229_10294454 | Not Available | 730 | Open in IMG/M |
3300028879|Ga0302229_10384374 | Not Available | 625 | Open in IMG/M |
3300029701|Ga0222748_1100749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Humibacillus → unclassified Humibacillus → Humibacillus sp. DSM 29435 | 562 | Open in IMG/M |
3300029939|Ga0311328_10384836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1013 | Open in IMG/M |
3300029943|Ga0311340_10232049 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
3300029943|Ga0311340_10357771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora | 1360 | Open in IMG/M |
3300029943|Ga0311340_10436830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1190 | Open in IMG/M |
3300029951|Ga0311371_11548941 | Not Available | 734 | Open in IMG/M |
3300030013|Ga0302178_10197285 | Not Available | 970 | Open in IMG/M |
3300030013|Ga0302178_10369643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
3300030056|Ga0302181_10207929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora | 903 | Open in IMG/M |
3300030056|Ga0302181_10377938 | Not Available | 614 | Open in IMG/M |
3300030058|Ga0302179_10066949 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
3300030490|Ga0302184_10185055 | Not Available | 883 | Open in IMG/M |
3300030490|Ga0302184_10344701 | Not Available | 589 | Open in IMG/M |
3300030509|Ga0302183_10146770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 926 | Open in IMG/M |
3300030580|Ga0311355_10892002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia spinosispora | 808 | Open in IMG/M |
3300030580|Ga0311355_11436711 | Not Available | 598 | Open in IMG/M |
3300030580|Ga0311355_11899340 | Not Available | 503 | Open in IMG/M |
3300030618|Ga0311354_10150942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2535 | Open in IMG/M |
3300030741|Ga0265459_10460748 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300031234|Ga0302325_12735041 | Not Available | 580 | Open in IMG/M |
3300031236|Ga0302324_103120040 | Not Available | 547 | Open in IMG/M |
3300031525|Ga0302326_10696495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1486 | Open in IMG/M |
3300031525|Ga0302326_13005736 | Not Available | 575 | Open in IMG/M |
3300031564|Ga0318573_10425203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Humibacillus → unclassified Humibacillus → Humibacillus sp. DSM 29435 | 714 | Open in IMG/M |
3300031713|Ga0318496_10511002 | Not Available | 664 | Open in IMG/M |
3300031770|Ga0318521_10085102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1714 | Open in IMG/M |
3300031778|Ga0318498_10460171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Humibacillus → unclassified Humibacillus → Humibacillus sp. DSM 29435 | 562 | Open in IMG/M |
3300031779|Ga0318566_10282113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus | 822 | Open in IMG/M |
3300031793|Ga0318548_10246689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 878 | Open in IMG/M |
3300031799|Ga0318565_10493788 | Not Available | 591 | Open in IMG/M |
3300031910|Ga0306923_10762715 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
3300031912|Ga0306921_11340910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
3300032041|Ga0318549_10149778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1038 | Open in IMG/M |
3300032828|Ga0335080_10506795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1281 | Open in IMG/M |
3300032896|Ga0335075_11221182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Humibacillus → unclassified Humibacillus → Humibacillus sp. DSM 29435 | 650 | Open in IMG/M |
3300033158|Ga0335077_10212826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2164 | Open in IMG/M |
3300034163|Ga0370515_0337693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 636 | Open in IMG/M |
3300034199|Ga0370514_147218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.75% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 23.76% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.89% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.95% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.96% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.97% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.97% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.97% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.97% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.97% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.98% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.98% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.99% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.99% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.99% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.99% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.99% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.99% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001634 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004977 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI20245J16306_10076111 | 3300001634 | Forest Soil | SQLARLRWEQAKHAAASGASTWRDHPNAKVRLVRRANSASD* |
Ga0062384_1011208531 | 3300004082 | Bog Forest Soil | EVPPSELARLKWEQAKHAAASGASTWRDHPNAKVRLVRRASSASD* |
Ga0062389_1025929172 | 3300004092 | Bog Forest Soil | LARLKWEQAKTAAASGAATWRDHPNAKVGLTRRNSPASG* |
Ga0072329_13967491 | 3300004977 | Peatlands Soil | PSELAKLKWEQAKTAAASGASTWREHPNAKARLVRREHTHGH* |
Ga0070766_107386031 | 3300005921 | Soil | KWEQAKTAAASGAATWRDHPNAKVRLVRRDSSASN* |
Ga0070766_110892881 | 3300005921 | Soil | ARLKWEQAKHAAASGASTWRDHPNAKVRLVRRATSASD* |
Ga0075030_1010976991 | 3300006162 | Watersheds | ETPPGQLARLKWEQARHAAVTGAGAWREHPNAKVGLARRASSD* |
Ga0116214_12312761 | 3300009520 | Peatlands Soil | PPGQLARLKWEQARHAAVTGAGAWRDHPNAKIGLARRASSD* |
Ga0116218_13765001 | 3300009522 | Peatlands Soil | KLKWEQAKTAAASGASTWREHPNAKARLVRREHTHGH* |
Ga0116221_14118972 | 3300009523 | Peatlands Soil | PGQLARLKWEQAKAAAVSGSATWRDHPNAKVGLARRSSSG* |
Ga0116133_10064291 | 3300009623 | Peatland | SQFAQLKWEQAKTAAASGADTWRAHPNAKVRLTRRPASSA* |
Ga0116216_106588041 | 3300009698 | Peatlands Soil | PSELAKLKWEQAKTAAASGASTWREHPNAKARLVRREHSPGH* |
Ga0116217_104781091 | 3300009700 | Peatlands Soil | EIPPSELAKLKWEQAKTAAASGASTWREHPNAKARLVRREHTPGH* |
Ga0116217_104782351 | 3300009700 | Peatlands Soil | ELAKLKWEQAKTAAASGASTWREHPNAKARLVRREHTHGH* |
Ga0116217_106348412 | 3300009700 | Peatlands Soil | EIPPSELAKLKWEQAKTAAASGASTWREHPNAKARLVRREHSPGH* |
Ga0136449_1016259072 | 3300010379 | Peatlands Soil | AKLKWEQAKTAAASGVSTWREHPNAKARLVRREVAP* |
Ga0126350_109993781 | 3300010880 | Boreal Forest Soil | ETPPSELAKLKWEQAKTAAASGAATWRDHPNAQVGISRKASQN* |
Ga0137776_13612761 | 3300010937 | Sediment | IKELETPPSQLARLRWEQAKAAAASGTATWRDHPNAKVGLARRSSSG* |
Ga0138555_11516511 | 3300011075 | Peatlands Soil | LAKLKWEQAKTAAASGASTWREHPNAKARLVRREHTHGH* |
Ga0153933_10834751 | 3300011411 | Attine Ant Fungus Gardens | QLARLKWEQAKSAATAGAATWRGHPNAQVRLARRAASAEG* |
Ga0181537_103685101 | 3300014201 | Bog | QAKTAAASGAATWRDHPNAKVRLVRRNSSVSDGS* |
Ga0181525_101744461 | 3300014654 | Bog | MELETPPSQIARLKWEQAKTAAASGANTWREHPNAKVRLVRRPADAAS* |
Ga0181522_101525171 | 3300014657 | Bog | RLKWEQAKTAAASGAATWRDHPNAKVRLVRRNSSASA* |
Ga0182035_120842982 | 3300016341 | Soil | TPPAELARLKWEQAKTAVASGTATWRDHPNAKIGLARRASSD |
Ga0187802_102748901 | 3300017822 | Freshwater Sediment | IRELEIPPSELAKLKWEQAKSAAASGASTWREHPNAKARLARREHAPRH |
Ga0187820_10420183 | 3300017924 | Freshwater Sediment | QLARLKWEQAKAAAVSGSATWRDHPNAKVGLARRGSSG |
Ga0187806_12457661 | 3300017928 | Freshwater Sediment | TPPGQLARLKWEQARHAAVTGAGAWRDHPNAKVGLARRASSD |
Ga0187847_102596291 | 3300017948 | Peatland | PSQFAQLKWEQAKTAAASGADTWRAHPNAKVRLTRRPASSA |
Ga0187815_102937311 | 3300018001 | Freshwater Sediment | RELEIPPSELAKLKWEQAKSAAASGASTWREHPNAKARLVRREHTHGH |
Ga0187884_101625863 | 3300018009 | Peatland | FAQLKWEQAKTAAGAGADTWRKHPNAQVRLTRRSASN |
Ga0187871_101799001 | 3300018042 | Peatland | VQELDVPPSQFAQLKWEQAKTAAASGASTWRGHPNAKVRLTRRPASSA |
Ga0187851_100889664 | 3300018046 | Peatland | PPSQFAQLKWEQAKTAAGAGADTWRKHPNAQVRLTRRSASN |
Ga0187851_101288693 | 3300018046 | Peatland | AKLKWEQAKTAAVSGANTWREHPNAKVRLVRRSANGGAE |
Ga0187784_109203821 | 3300018062 | Tropical Peatland | LETPPSQLARLKWEQAKAAAASGSATWREHPNAKVGIARRSSSG |
Ga0187784_113371812 | 3300018062 | Tropical Peatland | SQLARLKWEQAKAAAASGASTWQSHPNAKVGLARRNSSS |
Ga0206352_105744921 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | TPPDQLARLKWQQAKTAMAAGATSWREHPNAQVRLARRTATTAG |
Ga0210399_104465951 | 3300020581 | Soil | LETPPSELARLKWEQAKTAAASGAATWRDHPNAKVGLLRRSSARG |
Ga0210395_101569002 | 3300020582 | Soil | PPSELARLKWEQAKTAAATGASTWRDHPNAKVRLTRRGAAPAAD |
Ga0210401_107719011 | 3300020583 | Soil | KELETPPSELARLKWEQAKTAASSGAATWRDHPNAKVRLARRTS |
Ga0210405_114186202 | 3300021171 | Soil | LKWEQAKTAAASGAATWRDHPNAKVGLVRRNSARG |
Ga0210387_100957341 | 3300021405 | Soil | QLARLKWEQAKTAAAAGAATWRNHPNAKIGLARRVSD |
Ga0210391_104931422 | 3300021433 | Soil | RAWVNELETPPSQIARLKWEQAKTAAISGANTWRQHPNAKVRVLARGGNGGS |
Ga0242659_10820141 | 3300022522 | Soil | WVNELETPPSQIARLKWEQAKTAAISGANTWRQHPNAKVRVLPRGGNGRS |
Ga0242664_10178501 | 3300022527 | Soil | LARLKWEQAKHAAASGAATWRDHPNAKVRLARRTSSG |
Ga0242658_11633941 | 3300022530 | Soil | LETPPDQLARLKWEQAKTAAAAGAATWRNHPNAKIGLARRVSD |
Ga0242674_10268713 | 3300022711 | Soil | ARLKWEQAKHAAASGASTWRDHPNAKVRLVRRAISDSD |
Ga0242677_10284411 | 3300022713 | Soil | RLKWEQAKTAAISGAATWRDHPNAKVGLARLNSSS |
Ga0242678_10484392 | 3300022715 | Soil | KWEQAKTAAATGASTWRDHPNAKVRLIRRGAAQASD |
Ga0242666_11603411 | 3300022721 | Soil | KWEQAKTAAASGAATWRDHPNAKVRLVRRDSSASN |
Ga0242657_11514251 | 3300022722 | Soil | LARLRWEQAKTAMAAGTASWREHPNAKVRMRRISSDAD |
Ga0228598_11028481 | 3300024227 | Rhizosphere | PGQLARLKWEQAKSAASAGADTWRTHPHNRVRLVRRSS |
Ga0208714_10276801 | 3300025527 | Arctic Peat Soil | WIKELEIPPSELARLKWEQAKTAAASGVSTWREHPNAKARLVRRADTPR |
Ga0257154_10565751 | 3300026467 | Soil | ELARLKWEQAKTAAVSGAATWRDHPNAKVGLVRRKPARG |
Ga0209007_10562481 | 3300027652 | Forest Soil | WADELETPPGQLARLKWEQAKSAASAGADTWRTHPHNQVRLVRRSS |
Ga0209040_102512052 | 3300027824 | Bog Forest Soil | AKLKWEQAKTAAASGVSTWREHPNAKARLVRREVAP |
Ga0209415_104473523 | 3300027905 | Peatlands Soil | KELEVPPGQLARMKWEQAKSAAASGASTWREHPHSQVRLVRRAAADSD |
Ga0209006_102846873 | 3300027908 | Forest Soil | LETPPGELARLKWEQAKTAASSGAATWRDHPNAKIGLARRAASA |
Ga0209698_104116822 | 3300027911 | Watersheds | SELAKLKWEQAKSAAATGASTWREHPNAKARLVRREHMPSH |
Ga0209698_112135061 | 3300027911 | Watersheds | DLETPPGQLARLKWEQARHAAVTGAGAWREHPNAKVGLARRASSD |
Ga0302218_100674932 | 3300028863 | Palsa | KELETPPSQIAKLRWEQAKTAAASGANTWREHPNAQVRLVRRSANGGSE |
Ga0302235_101904951 | 3300028877 | Palsa | WEQAKTAAVSGANTWREHPNAKVRLVRRSANGGSA |
Ga0302229_102944541 | 3300028879 | Palsa | LDVPPSQFAQLKWEQAKTAAGAGADTWRKHPNAQVRLTRRSASN |
Ga0302229_103843741 | 3300028879 | Palsa | ELETPPSQIARLKWEQAKTAAVSGANTWREHPNAKVRLVRRGANGGS |
Ga0222748_11007492 | 3300029701 | Soil | VKELETPPSELARLKWEQAKTAAASGAATWRDHPNAKVGLVRRNSARG |
Ga0311328_103848363 | 3300029939 | Bog | QQLDVPPSQFAQLKWEQAKTAAASGANTWRAHPNAKVRLTRRPASSA |
Ga0311340_102320491 | 3300029943 | Palsa | ARLKWEQAKSAAVSGASTWREHPNAKVGLARRGANGS |
Ga0311340_103577711 | 3300029943 | Palsa | PGLDQGAGTPPSQIARLKWEQAKTAAVSGANTWREHPNAKVRLVRRGANGGS |
Ga0311340_104368302 | 3300029943 | Palsa | TPPGEIARLKWEQAKTAAVSGANTWREHPNAKVRLVRRSANGGSA |
Ga0311371_115489411 | 3300029951 | Palsa | VQELDVPPSQFAQLKWEQAKTAAASGANTWRAHPNAKVRLTRRPASSA |
Ga0302178_101972851 | 3300030013 | Palsa | KWEQAKTAAASGAATWRDHPNAKVRLVRRNSSASD |
Ga0302178_103696433 | 3300030013 | Palsa | IARLKWEQAKTAAVSGANTWREHPNAKVRLVRRSANGGSA |
Ga0302181_102079291 | 3300030056 | Palsa | WIKELETPPSQIARLKWEQAKTAAVSGANTWREHPNAKVRLVRRGANGGS |
Ga0302181_103779382 | 3300030056 | Palsa | FAQLKWEQAKTAAASGANTWRAHPNAKVRLTRRPASSA |
Ga0302179_100669491 | 3300030058 | Palsa | LDVPPSQFAQLKWEQAKTAAASGANTWRAHPNAKVRLTRRPASSA |
Ga0302184_101850551 | 3300030490 | Palsa | DQGAGTPPSQIARLKWEQAKTAAVSGANTWREHPNAKVRLVRRGANGGS |
Ga0302184_103447013 | 3300030490 | Palsa | AWIKELETPPSQIARLKWEQAKTAAVSGANTWREHPNAKVRLVRRGANGGS |
Ga0302183_101467703 | 3300030509 | Palsa | PPSQFAQLKWEQAKTAAASGANTWRAHPNAKVRLTRRPASSA |
Ga0311355_108920021 | 3300030580 | Palsa | LARLKWEQAKSAAVSGASTWREHPNAKVGLARRGANGS |
Ga0311355_114367111 | 3300030580 | Palsa | TRAWIKELETPPGEIARLKWEQAKTAAVSGANTWREHPNAKVRLVRRSANGGSA |
Ga0311355_118993402 | 3300030580 | Palsa | GQLAKLKWEQAKSAAAAGAATWQEHPNAQVSLAPHRVSSV |
Ga0311354_101509421 | 3300030618 | Palsa | QIARLKWEQAKTAAVSGANTWREHPNAKVRLVRRGANGGS |
Ga0265459_104607481 | 3300030741 | Soil | VKELETPPSELARLKWEQAKTAAVSGAATWRDHPNAKVSLVRRRSSG |
Ga0302325_127350411 | 3300031234 | Palsa | ETPPGEIARLKWEQAKTAAVSGANTWREHPNAKVRLVRRSANGGSA |
Ga0302324_1031200402 | 3300031236 | Palsa | AQLKWEQAKTAAASGANTWRAHPNAKVRLTRRPASSA |
Ga0302326_106964951 | 3300031525 | Palsa | SQIARLRWEQAKTAAVSGANTWREHPNAKVRLVRRGANGGS |
Ga0302326_130057362 | 3300031525 | Palsa | IKELETPPSQIARLKWEQAKTAAVSGANTWREHPNAKVRLVRRGANGGS |
Ga0318573_104252031 | 3300031564 | Soil | PGQLARLKWEQAKAAAVSGAGTWRDHPNAKVGLARRASSS |
Ga0318496_105110021 | 3300031713 | Soil | IKEQETTPAQLARLRWEQARAAAVSGAATWRDHPNAKIGLARRASSSSD |
Ga0318521_100851024 | 3300031770 | Soil | PSQLAKLKWEQARAAAVSGAGAWRDHPNAKVGLARRASSD |
Ga0318498_104601712 | 3300031778 | Soil | LARLKWQQAKAAAVSGASTWRDHPNAKVGLARRDSSS |
Ga0318566_102821131 | 3300031779 | Soil | INELETPPSELARLKWQQAKHAATTGAGAWRDHPNAKVGLARRTSAS |
Ga0318548_102466891 | 3300031793 | Soil | PSELARLKWQQAKAAAVSGASTWRDHPNAKVGLARRDSSN |
Ga0318565_104937881 | 3300031799 | Soil | QLARLRWEQARAAAVSGAATWRDHPNAKIGLARRASSSSD |
Ga0306923_107627153 | 3300031910 | Soil | TPPSQLAWLKWEQARAAAVSGAATWRDHPNSKVGLARRASSD |
Ga0306921_113409103 | 3300031912 | Soil | ELETPPSELARLKWQQAKAAAVSGASTWRDHPNAKVGLARRDSSN |
Ga0318549_101497781 | 3300032041 | Soil | ELETPPSELARLKWQQAKAAAVSGASTWRDHPNAKVGLARRDSSS |
Ga0335080_105067953 | 3300032828 | Soil | PPSQFAQLKWEQAKTAAATGASTWREHPNAKVRLTRRPASSD |
Ga0335075_112211821 | 3300032896 | Soil | ELETPPSQLARLKWEQAKAAASSGASTWQDHPNAKIGLARRNSGS |
Ga0335077_102128264 | 3300033158 | Soil | SQFAQLKWEQAKTAAATGASTWREHPNAKVRLTRRPASSD |
Ga0370515_0337693_1_141 | 3300034163 | Untreated Peat Soil | LETPPDQLARLRWEQAKAAAAAGASTWRGHPNARVRLASRGSSEPD |
Ga0370514_147218_3_122 | 3300034199 | Untreated Peat Soil | ARLRWEQAKTAAAAGAATWRGHPNAKVRLVRRASYAGLS |
⦗Top⦘ |