NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103723

Metagenome / Metatranscriptome Family F103723

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103723
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 115 residues
Representative Sequence MNPAKQPTGTESAETEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVALETSALHDFMQSNHADVVLIAGNHLPDLSLLRWLRVSYPKIVPILLAESDDRELV
Number of Associated Samples 88
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 53.00 %
% of genes near scaffold ends (potentially truncated) 96.04 %
% of genes from short scaffolds (< 2000 bps) 92.08 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.68

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.059 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(20.792 % of family members)
Environment Ontology (ENVO) Unclassified
(49.505 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(40.594 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.24%    β-sheet: 18.18%    Coil/Unstructured: 57.58%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.68
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF00072Response_reg 9.90
PF10531SLBB 9.90
PF02563Poly_export 6.93
PF02706Wzz 2.97
PF00589Phage_integrase 1.98
PF00196GerE 0.99
PF00665rve 0.99
PF01370Epimerase 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG1596Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp foldCell wall/membrane/envelope biogenesis [M] 6.93
COG3206Exopolysaccharide export protein/domain GumC/Wzc1Cell wall/membrane/envelope biogenesis [M] 2.97
COG3524Capsule polysaccharide export protein KpsE/RkpRCell wall/membrane/envelope biogenesis [M] 2.97
COG3765LPS O-antigen chain length determinant protein, WzzB/FepE familyCell wall/membrane/envelope biogenesis [M] 2.97
COG3944Capsular polysaccharide biosynthesis protein YveKCell wall/membrane/envelope biogenesis [M] 2.97
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.99
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.99
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.99
COG4584TransposaseMobilome: prophages, transposons [X] 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.06 %
UnclassifiedrootN/A5.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004080|Ga0062385_10081668All Organisms → cellular organisms → Bacteria1509Open in IMG/M
3300004091|Ga0062387_100523476All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7833Open in IMG/M
3300004091|Ga0062387_101358884All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chromobacterium group → Chromobacterium → Chromobacterium haemolyticum564Open in IMG/M
3300004092|Ga0062389_100724829All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300004152|Ga0062386_100576951All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7918Open in IMG/M
3300005468|Ga0070707_100247534All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71735Open in IMG/M
3300005575|Ga0066702_10761467All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7576Open in IMG/M
3300005995|Ga0066790_10160580All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7962Open in IMG/M
3300006041|Ga0075023_100079135All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71096Open in IMG/M
3300006052|Ga0075029_100802071All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7641Open in IMG/M
3300006059|Ga0075017_100540697All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7887Open in IMG/M
3300006174|Ga0075014_100005880All Organisms → cellular organisms → Bacteria3961Open in IMG/M
3300006797|Ga0066659_10481738All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7991Open in IMG/M
3300009524|Ga0116225_1344412All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7664Open in IMG/M
3300009617|Ga0116123_1178524All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7542Open in IMG/M
3300009621|Ga0116116_1046913All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71324Open in IMG/M
3300009639|Ga0116122_1237296All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7566Open in IMG/M
3300009643|Ga0116110_1081831All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71114Open in IMG/M
3300009645|Ga0116106_1011165All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA73302Open in IMG/M
3300009792|Ga0126374_10905103Not Available684Open in IMG/M
3300010339|Ga0074046_10616068All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7641Open in IMG/M
3300010343|Ga0074044_10875575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7587Open in IMG/M
3300010366|Ga0126379_12218347Not Available650Open in IMG/M
3300014155|Ga0181524_10375180All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7627Open in IMG/M
3300014496|Ga0182011_10637212All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7676Open in IMG/M
3300014638|Ga0181536_10103702All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71607Open in IMG/M
3300014839|Ga0182027_11357407All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7706Open in IMG/M
3300015193|Ga0167668_1074735All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7667Open in IMG/M
3300017823|Ga0187818_10090105All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71325Open in IMG/M
3300017823|Ga0187818_10247734All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7779Open in IMG/M
3300017934|Ga0187803_10480826All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7507Open in IMG/M
3300017935|Ga0187848_10198911All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7862Open in IMG/M
3300017935|Ga0187848_10224718All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7799Open in IMG/M
3300017940|Ga0187853_10343688All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7667Open in IMG/M
3300017940|Ga0187853_10483730All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7541Open in IMG/M
3300017941|Ga0187850_10277082All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7748Open in IMG/M
3300017941|Ga0187850_10332638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus roseus669Open in IMG/M
3300017943|Ga0187819_10247315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71044Open in IMG/M
3300017946|Ga0187879_10769653All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7537Open in IMG/M
3300018006|Ga0187804_10282297All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7721Open in IMG/M
3300018008|Ga0187888_1212107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7765Open in IMG/M
3300018012|Ga0187810_10152196All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7929Open in IMG/M
3300018020|Ga0187861_10070568All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71753Open in IMG/M
3300018021|Ga0187882_1238366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7707Open in IMG/M
3300018030|Ga0187869_10193034All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7998Open in IMG/M
3300018033|Ga0187867_10274293All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7947Open in IMG/M
3300018034|Ga0187863_10595993All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7622Open in IMG/M
3300018037|Ga0187883_10305317All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7813Open in IMG/M
3300018037|Ga0187883_10427987All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7679Open in IMG/M
3300018037|Ga0187883_10727392All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7518Open in IMG/M
3300018038|Ga0187855_10470222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7732Open in IMG/M
3300018042|Ga0187871_10802782Not Available525Open in IMG/M
3300018043|Ga0187887_10359663All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7859Open in IMG/M
3300018046|Ga0187851_10730936All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7557Open in IMG/M
3300018086|Ga0187769_10978160All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7640Open in IMG/M
3300019785|Ga0182022_1035284All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71500Open in IMG/M
3300021088|Ga0210404_10388015All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7779Open in IMG/M
3300021407|Ga0210383_10829569Not Available790Open in IMG/M
3300021433|Ga0210391_10114268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72126Open in IMG/M
3300021474|Ga0210390_10375250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71203Open in IMG/M
3300025414|Ga0208935_1028967Not Available733Open in IMG/M
3300025414|Ga0208935_1040457All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7620Open in IMG/M
3300025419|Ga0208036_1056472All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7656Open in IMG/M
3300025473|Ga0208190_1031134All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71192Open in IMG/M
3300025500|Ga0208686_1126366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7527Open in IMG/M
3300025507|Ga0208188_1063465All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7895Open in IMG/M
3300025507|Ga0208188_1067695All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7856Open in IMG/M
3300025507|Ga0208188_1125494All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7559Open in IMG/M
3300025878|Ga0209584_10155146All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7863Open in IMG/M
3300025928|Ga0207700_10040064All Organisms → cellular organisms → Bacteria → Acidobacteria3416Open in IMG/M
3300026217|Ga0209871_1015417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1421Open in IMG/M
3300027388|Ga0208995_1034102All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7893Open in IMG/M
3300027604|Ga0208324_1024969All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71824Open in IMG/M
3300027634|Ga0209905_1063904All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7597Open in IMG/M
3300027678|Ga0209011_1009130All Organisms → cellular organisms → Bacteria → Acidobacteria3342Open in IMG/M
3300027678|Ga0209011_1176369All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7592Open in IMG/M
3300027692|Ga0209530_1164851All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7618Open in IMG/M
3300027803|Ga0209910_10047878All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7519Open in IMG/M
3300027825|Ga0209039_10230866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7744Open in IMG/M
3300027846|Ga0209180_10351342All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7841Open in IMG/M
3300027905|Ga0209415_11107109All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7515Open in IMG/M
3300028069|Ga0255358_1064142All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7526Open in IMG/M
3300028906|Ga0308309_10094063All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72301Open in IMG/M
3300029817|Ga0247275_1046766All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71234Open in IMG/M
3300029903|Ga0247271_102069All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4692Open in IMG/M
3300029944|Ga0311352_10291089All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71363Open in IMG/M
3300029951|Ga0311371_12620741All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7508Open in IMG/M
3300030054|Ga0302182_10115708All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71173Open in IMG/M
3300030057|Ga0302176_10149739All Organisms → cellular organisms → Bacteria → Acidobacteria925Open in IMG/M
3300030509|Ga0302183_10173994All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7843Open in IMG/M
3300030524|Ga0311357_10889605All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7792Open in IMG/M
3300030707|Ga0310038_10368485All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7631Open in IMG/M
3300030707|Ga0310038_10441211All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7559Open in IMG/M
3300030815|Ga0265746_1031930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7681Open in IMG/M
3300031344|Ga0265316_11018421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7576Open in IMG/M
3300031708|Ga0310686_106553747All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71816Open in IMG/M
3300031754|Ga0307475_11451988All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7527Open in IMG/M
3300034070|Ga0334822_044030All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7977Open in IMG/M
3300034282|Ga0370492_0037474All Organisms → cellular organisms → Bacteria → Acidobacteria1993Open in IMG/M
3300034282|Ga0370492_0463189All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7514Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland20.79%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland12.87%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil5.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.94%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.94%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.95%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.96%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.96%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen2.97%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.98%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.98%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.98%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost1.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.98%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.98%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.99%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.99%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.99%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.99%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.99%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015193Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300027388Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027634Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1MEnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027803Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3SEnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028069Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029903Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703EnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300034070Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-MEnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062385_1008166813300004080Bog Forest SoilMMDVKTSRSTNPSTEAAVASPTVNVLVADSGPIQSQLLARALKARREFQVSAVALDISALHDFLQSNPVDVVLIAWSHSPDLGLLRWLRVSYPKIAPVLL
Ga0062387_10052347623300004091Bog Forest SoilMRSTNQPSENPAVETETVQVLVADSGPIQSQLLTRALKSRRDFEVSAVALETSALQDFLQSNRADVVLIAGNHLPDLSLLRWLRLSYPQVAPVLLIESDDREMV
Ga0062387_10135888413300004091Bog Forest SoilVKVLVADSGPIQSQLLARALKGRREFLVSVVALEASAIRDCMQSNPADVILIAGNHKPDLSLLRWLRVSYPKIAPVLLAESEDRE
Ga0062389_10072482913300004092Bog Forest SoilMDRTSGPCAFGDDEGVNTIRETKQKPTTEPEPATSASEPVQLLVADSGAIQSQLLTRALKSRKDFQVSAVALETSALHQFMQTNRADVVLVAGNHLPDLSLLRWLRVSYPKVAPVLLAENDDRELVVNAFR
Ga0062386_10057695113300004152Bog Forest SoilMINATRPEKQPAETKLVETETIRVLVADSGAIQSQLLARALKGRRDFQVSAVALETLALRDFMQSNHADVVLIAGNHLPDLSLLRWLRVSYPKVAPVLLAESDD
Ga0070707_10024753413300005468Corn, Switchgrass And Miscanthus RhizosphereMSATKPSTGTPPVETETVQVLVADSGPIQSQLLTRALKSRREFQVSAVALQTSAVHNFMQSNHADVVLVAGNRLPDFSLLRWLRVSYPKVAPVLLAESDDRELVVNALRAGAK
Ga0066702_1076146713300005575SoilMRHTSGPSPFGHNRDVKTIRSAQPSTGTRPAATEVVHVLVADSGPIQSQLLTRALKSRRDFKVSAVALDTTALHNFMQSNRADVVLIAGNHLPDLSLLRWLRVSYPKIAPVLLAESDDR
Ga0066790_1016058023300005995SoilMGPTSGPCALGHDGNVHTIRTKKQKPSTPAIPTVPAATVVVKVLVADSGPIQSQLLTRALKSRRDFKVSAVALETSALHNFMQSNPVDVVLIAGNRLPDLSLLRWLRISYPKVAPVLLAENDGRELVVNAFRA
Ga0075023_10007913513300006041WatershedsVPVGHDGNVKTIRSAEPSTGIQLAAPEPVKVLVADSGPIQSQLLTRALKARRDFHVSAVPLETSALNDFLQSNHADVVLIAGSQVPDLSLLRWLRVSFPRIAPVLLAEGDDRELVVNALR
Ga0075029_10080207113300006052WatershedsVNTLHATKQKPSTDPVPGATEVVQVLVADSGPIQSQLLTRALKSRRDFHVSAVALETSALHKFLQSNHADVVLIAGNHLPDLSLLRWLRVSYPKIAPV
Ga0075017_10054069713300006059WatershedsVHQSGPSKVDIEGDIHHQRSVMGPTYGPGAFGHHGRVKTNHLVKHSSADRPIATEAVHVVVADSSPIQSQLLTRALKNRRDFQVSSVALETSALDNVLQSNHADVVLVAGNHLPDLGLLRWLRISYP
Ga0075014_10000588013300006174WatershedsMNTPLVKPSKKPCLIATEPIQVLVADSSPIQSQLLTRALRARRDLHVAAVALEAAAVHGFMQSNHVDVILVASSNLPDLSMLRWLRVSYPKTAPVLLVERDDREMVVN
Ga0066659_1048173823300006797SoilMRHTSGPSPFGHNRDVKTIRSAQPSTGTRPAATEVVHVLVADSGPIQSQLLTRALKSRRDFKVSAVALDTTALHNFMQSNRADVVLIAGNHLPDLSLLRWLRVSYPKIAPVLLAE
Ga0116225_134441213300009524Peatlands SoilVKTICSAKPSSATTPVATGTVQVLVADSGPIQSQLLTRALKSRRDFQVSSVALDTSAIHTFMQSNQADVVLIAGNHLPDLSLLRWLRVSYPKMAPVLLAES
Ga0116123_117852413300009617PeatlandMERGIHHQQGVTKPTSGPCVFGHDGSVKTMHSAKQSTGIAPVETEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVALETSALHDFMQSNHVDVVLIAGNHLADCSLLRWLRV
Ga0116116_104691333300009621PeatlandMERGIHHQQGVTKPTSGPCVFGHDGSVKTMHSAKQSTGIAPVETEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVALETSALHDFMQSNHVDVVLIAGNHLADCSLLRWLRVSYPKVAPVLLVESDDREQVVNALR
Ga0116122_123729613300009639PeatlandVNTIRSGKQATGTQAVETETVQVVIADSGPIQSQLLTRALKGRRDFQVSAVALETAALHDFMQSNPADVVLIAGNHLPDLSLLRWLRVSYPKVAPVLLIESDDRELVVNALRAGAKGIFLFTHTPFTMLCKCI*
Ga0116110_108183113300009643PeatlandVKTIHLAKQSTGTPPAAIETVQVVVADSSPIQSQLLTRALKDRRDFQVSAVALETSALDHFLQSNHADVALVAGNHLPDLSLLRWLRVSYPKIAPVLLAENDDRELVVNALRAGAK
Ga0116106_101116513300009645PeatlandMERGIHHQQGVTKPTSGPCVFGHDGSVKTMHSAKQSTGIAPVETEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVALETSALHDFMQSNHVDVVLIAGNHLADCSLLRWLRVSYPKVAPVLLVESDDREQVVNALRAGAR
Ga0126374_1090510323300009792Tropical Forest SoilMRAQPEGLIAVQDKEETATIRVLVADSAPIQSQLLVRALKARREFQVFSAALEAAILHEFMHSTPVDVVLMAGNHVPNLSLLRWLRTSHPKVAPVLLVEHGDRALVVNAFR
Ga0074046_1061606813300010339Bog Forest SoilMRATKQSTETGSAAAEVVQVLVADSSPIQSELLTRALKSRRDFQVSAVALETSALHNFMQSNRADVVLIAGNHLPDLSLLRWLRVSYPKIAPVL
Ga0074044_1087557513300010343Bog Forest SoilMNSERATKQKPTAESVPATSPSEIVQLLVADSGAIQSQLLTRALKSRKDFQVSAVALETEVLHKFLQSNPADVVLVAGSHSPDLSLLRWLRVSHPKVAPVLLVENDDR
Ga0126379_1221834713300010366Tropical Forest SoilVKSSSSGKLQAPPATQKDVVRVLVADSGAIQSQLLTRALKARRDLQVSAVALEVPALHSFMQSNTPDVVLIAGHHLPDLGLVRWLHVSYP
Ga0181524_1037518013300014155BogVKTIRSTKSSTGTGLVETETMHVLIADSGPIQSQLLTRALKNRREFKVSAVALEASALHNFLQSNHADVVLMAGNHLPDLSLLRWLRTSYPKVAPV
Ga0182011_1063721213300014496FenMRSAKQPTVTTPPAAEVVHVLVADSGPIQSQLLTRALKNRREFQVSAVALETSAIHEFMQATPADVVLIAGSQLPDLSLLRWLRVSYPRIAPVLLAESDDRE
Ga0181536_1010370223300014638BogMVGVKTINPAKQPTGTESAGTEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVALETSALHNFMQSNHADVVLIAGNHLPDLSLLRWLRVSYPKVAPILLA
Ga0182027_1135740713300014839FenMNPAKQPTGTESAETEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVALETSALHDFMQSNHADVVLIAGNHLPDLSLLRWLRVSYPKIVPILLAESDDRELV
Ga0167668_107473513300015193Glacier Forefield SoilMKIDHAVTQPATDEIIDSQLVRVLIADSGPIQSQLLARALKGRREFSVSTVDLDISALRNFLQSNGADVILIAGNRLPDSGLLRWLRVSHPKIAPVLLAENDEREVVLNALRAGAKGIFLFSQ
Ga0187818_1009010523300017823Freshwater SedimentMRSAKLATGNPAVETEIVRVLVADSGPIQSQLLTRALKSRRDFQVSAVALEASALHNFLQSNNADVVLVAGNHLPDLSLLRWLRVSYPSIAPVLLAENDDR
Ga0187818_1024773413300017823Freshwater SedimentMRSAKLATGNPAVETEIVRVLVADSGPIRSQLLTRALNSRRDLQVSAVALEMSALQTFLQANHSDVVLVAGNHLPDLSLLRWLRVSYPNIAPVLLAENDDRELVVNALRAGGKGIF
Ga0187803_1048082613300017934Freshwater SedimentGIMNAQFPIESSLAPTPAATETIQVLIADSSPIQSQLLTRALKARRELRVFAIALEAAALHSFMQSNHPDVVLIAANNLPDLSLLRWLRISYPNTAPILLVESDDREM
Ga0187848_1019891113300017935PeatlandMRSAKLATGTPTVETEIVQVLVADSGLIQSQLLTRALKSRRDFEVSAAALETSALQNFLQSNHADVVLVAGNHQPDLSLLRWLRVSYPNIAPILLAENDDRELVVNAL
Ga0187848_1022471823300017935PeatlandMVHNRGPAKVDNNLPIRHQRGVMGPTYDPYALGHDGSVNTLRVTRQTRLSKPKPPAKTAPDVTEVVHVLVADSGPIQSQLLTRALKCRRDFQVSAVALEASALHKFLQSNQADVILIAGNHLPDLGLLRWLRLSYPKVAPVLLAESDDRELVV
Ga0187853_1034368813300017940PeatlandVKTIHLAKQSTGTPPAAIETVQVVVADSSPIQSQLLTRALKDRRDFQVSAVALETSALDHFLQSNHADVALVAGNHLPDLSLLRWLRVSYPKIAPVLLAEN
Ga0187853_1048373013300017940PeatlandMRSAKLATGTPTVETEIVQVLVADSGLIQSQLLTRALKSRRDFEVSAVALETSALQNFLQSNNADVVLVAGNHQPDLSLLRWLRVSYPKIAPVLLAENDDRELVVNALRAGAKGIFLFTQTPFPMLC
Ga0187850_1027708213300017941PeatlandMRSPKLATRTPTVETEIVQVVVADSSPIQSQLLTRALKSRRDFQVSAVALETSALHDFMQSNQTDVVLVAGNHLPDLSLLRWLRISYPKIAPVLLAENDDRELVVNAL
Ga0187850_1033263813300017941PeatlandMSTIRSAKQATGTQTVEPETVQVLVADSGQIQSQLLARALKGRRDFQVSAVALETAALHDFLQSNPADVVLIAGNHLPDLNLLRWLRVSYPKVAPVLLIESDDRELVVNAFRAGAKGIFLFTDTPFTMLCKCIQCVF
Ga0187819_1024731513300017943Freshwater SedimentVKTLRSAELSSGTPPAEAEAVKVLIADSGPIQSQLLTRALKSRREFDVSAVALDTAALHDFMQSNPTDVVLVAGNHLPDLGLLRWLRVSYPKAAP
Ga0187879_1076965313300017946PeatlandMGATSGPCAFGHDSRVKTHHVARHTIDPPPAAIESVQVVVADSSPIQSQLLTRALKGRRDFQVSAVPLETTALDNFLQSSRADVALVAGNHLPDLGLLRWLRVSYPKVAPVLLAENDDRELVVNALRAGA
Ga0187876_129404713300018003PeatlandMRSPKLATRTPTVETEIVQVVVADSSPIQSQLLTRALKSRRDFQVSAVALETSALHDFMQSNQTDVVLVAGNHPPDLSLLRWLRISYPKI
Ga0187804_1028229723300018006Freshwater SedimentMRSAKLATGTPTVETEIVRVLVADSGPIQSQLLTRALKGRRDFQVSAVALETSALHHFLQSNHADVVLVAGNHLPDLSLLRWLRVSYPNIAPVLLAENDDRELVLNALRAGAK
Ga0187888_121210713300018008PeatlandMGPTSGPCALVHNGDVKTMNPAKQPTGTESAETEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVALETSALHDFMQSNHADVVLIAGNHLPDLSLLRWLRVTYPKVAPILLAESDDRELVVNAFR
Ga0187810_1015219613300018012Freshwater SedimentMNAGPPAKLSKVPRSGTTEAIQVLVADSSPIQSQLLTRALRARRELRVSAVALDAALLHDFMQSNPADVVLIAGNNLPDLSLLRWLHISYPKVSPVLLVESDDREM
Ga0187861_1007056823300018020PeatlandMERGIHHQQGVTKPTSGPCVFGHDGSVKTMHSAKQSTGIAPVETEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVALETSALHDFMQSNHVDVVLIAGNHLADCSLLRWLRVSYPKVAPVLLV
Ga0187882_123836613300018021PeatlandMRSAKLATGTPTVETEIVQVLVADSGLIQSQLLTRALKSRRDFEVSAAALETSALQNFLQSNHADVVLVAGNHQPDLSLLRWLRVSYPNIAPILLAENDDRELVVNALRAGAKG
Ga0187869_1019303413300018030PeatlandMRSPKLATRTPTVETEIVQVVVADSSPIQSQLLTRALKSRRDFQVSAVALESSALHDFMQSNPTDVVLVAGNHPPDLSLLRRLRISYPKIAPVLLAENDDRELVVNALRAGAKGIFLFTQTSF
Ga0187867_1027429323300018033PeatlandMVHNRGPAKVDNNLPIRHQRGVMGPTYDPYALGHDGSVNTLRVTRQTRLSKPKPPAKTAPDVTEVVHVLVADSGPIQSQLLTRALKCRRDFQVSAVALEASALHKFLQSNQADVILIAGNHLPDLGLLRWLRLSYPKVAPVLLAESDDR
Ga0187863_1059599313300018034PeatlandMEATYGPCALGHDRTVKNVRSEKQPGEIPAVVTETVQVLIADSSPIQSQLLTRALNVRRDFQVAAVALETSALHNFLESNHADVVLITGNHLPDLSVLRWLRVSYPKIAPVLLAENDD
Ga0187883_1030531713300018037PeatlandMRSAKLATGTPTVETEIVQVLVADSGLIQSQLLTRALKSRRDFEVSAVALEMSALQNFLQSNNADVVLVAGNQQPDLSLLRWLRVSYPKIAPVLLVENDDRELVVNALRAGAKGIFLFTQTPFPMLCKCI
Ga0187883_1042798713300018037PeatlandMRSPKLATRTPTVETEIVQVVVADSSPIQSQLLTRALKSRRDFQVSAVALETSALHDFMQSNQTDVVLVAGNHPPDLSLLRWLRVSYPKIAPVL
Ga0187883_1072739213300018037PeatlandMGPTSGPCALGHDGSVNTIRTSKQPPSTVAATAASEIVQLLVADSGAIQSQLLTRALKGRKDFQVSAVALETSALHDFMQSNRADVVLIAGNHLPDLSLLRWLRVSYPKV
Ga0187855_1047022213300018038PeatlandMRGRIHHQQSVMTPTSDPCALGHDGSVNTIRSGKQATGTQAVETETVQVVIADSGPIQSQLLTRALKGRRDFQVSAVALETAALHDFMQSNPADVVLIAGNHLPDLSLLRWLRVSYPKVAPVLLIESDDRELVVNALRAGAKGIFLFTHTPFTML
Ga0187871_1080278213300018042PeatlandVRVLVADSGAIQSQLLTRALKSRRDFQVSAVALEMTTVQDFLQANQVDVVLIAATRLPDLSLLYWLRLSYPRIASVLLVDSDDRELVVNALRAG
Ga0187887_1035966313300018043PeatlandMEATYGPCALGHDRTVKNVRSEKQPGEIPAVVTETVQVLIADSSPIQSQLLTRALNVRRDFQVAAVALETSALHNFLESNHADVVLITGNHLPDLSVLRWLRVSYPKIAPVLLAENDDRELV
Ga0187851_1073093613300018046PeatlandMRSAKLATGTPTVETEIVQVLVADSGLIQSQLLTRALKSRRDFEVSAVALEMSALQNFLQSNNPDVVLVAGNQQPDLSLLRWLRVSYPKIAPVLLVENDDRE
Ga0187769_1097816013300018086Tropical PeatlandMGIVSAPRVTKQRPSTSPAQAASDVVHVLVADSGPIQSQLLTRALKSRKDFEVSAAALEVKALDEFLQAKPADVVLLAGNRLPDLNLLRWLRVSHPKAAPVLLAENDDRELVVSAFRAGAKGIFLFAQTPFPM
Ga0182022_103528423300019785FenVRIHHQQGVMGPTYGPCALGHNDGVKTMHATKQATGSHPVATEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVALETDALHNFMESNRADVVLIAGNHLPDLSLLRWLRVSHPKIAPVLLAETDDRELVVNAFRAGARGIFLFAH
Ga0210404_1038801513300021088SoilMRHTSGPSPFGHNDGVKTIRSAKPSTGTRPAATEAVHVLVADSGPIQSQLLTRALKSRRDFKVSAVALDTTALHSYLQSNHADVVLIAGNHLPDLSLLRWLRVSYPKIAPVLLAENDDRELVVNAFR
Ga0210383_1082956913300021407SoilVPIHHQRTVTGSTYGPPAFGHDRSVKTIQATKLPKITAPVETETVQVLVADSGPIQSQLLTRALKGRRDFQVSAVALETSALEDFIQSNPVDVVLVAGNHLPDL
Ga0210391_1011426843300021433SoilMVPTYGPCRLVHDDCMSIMRTTKLSTAAPAVEPETVRVLVADSGAIQSQLLTRALKERRDLEVSAVALEGSALQDFMQSNSADVVLIAGNHLKDFGLLRWLRVTYPGVATVLLTENDDRDLVVSAM
Ga0210390_1037525013300021474SoilMVPTYGPCRLVHDDCMSIMRTTKLSTAAPAVEPETVRVLVADSGAIQSQLLTRALKERRDLEVSAVALEGSALQDFMQSNSADVVLIAGNHLKDFGLLRWLRVTYPGVATVLLTENDDRDLVVSAMR
Ga0208935_102896713300025414PeatlandVNIPRTAKQPTSTTATPAIQPEIVRVLVADSGAIQSQLLTRALKSRRDFQVSAVALEMTTVQDFLQANQVDVVLIAATRLPDLSLLYWLRLSYPRIASVLLVDSDDRELVVNALRAGAKGIFLF
Ga0208935_104045723300025414PeatlandMRSTNLVPDAPAIAAQTVEVLIADSGPIQSQLLARALKVRREFQVSAVALETSALHDYLQSRHADVVLIAGNHLPDLSLLRWLRVSYPKIAPVLLSENDDRELVVSALRAGAKGIFLFSHNPF
Ga0208036_105647213300025419PeatlandMHSAKQSTGIAPVETEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVALETSALHDFMQSNHVDVVLIAGNHLADCSLLRWLRVSYPKVAPVLLAES
Ga0208190_103113423300025473PeatlandVHISSPSKVDIPTPIRHKQSVTGPTSGPCALGHDGTVKNTRTTHQVLDPPVIETETVQVLIADSGLIQSQLLTRALKGRRDFQVSAVALEASALDNYLQSNHADVILIAGNHLPDLSLLRWLRVSHPKIAPVLLSENDDRELVVSA
Ga0208686_112636613300025500PeatlandMRSAKQSTGTGPAETEMVQVLVADSGPIQSQLLTRALKSRREFQVSAVALETAVIHNFMQSNHADVVLIAGNHLPDLSLLRWLRVSYPKIAPVLLAESDDRELVVNAFRA
Ga0208188_106346513300025507PeatlandMERGIHHQQGVTKPTSGPCVFGHDGSVKTMHSAKQSTGIAPVETEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVALETSALHDFMQSNHVDVVLIAGNHLADCSLLRWLRVSYPKVAPVLLVESDDREQVVNALRA
Ga0208188_106769513300025507PeatlandMVGVKTINPAKQPTGTESAGTEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVALETSALHDFMQSNHADVVLIAGNHLPDLSLLRWLRVTYPKVAPILLAESDDRELVVNAFRAGAKGIFLFTHTPF
Ga0208188_112549413300025507PeatlandVKTIHLAKQSTGTPPAAIETVQVVVADSSPIQSQLLTRALKDRRDFQVSAVALETSALDHFLQSNHADVALVAGNHLPDLSLLRWLRVSYPKIAPVLLAENDDRELVVNALR
Ga0209584_1015514613300025878Arctic Peat SoilVTTLSPHSSIAAEVAGTEIIQILVVDSRPIQSQLLARALQSRRDFNVSSVALETVAVHDFMQSHRVDVVLIAANHLPDLPLLRWLRTSYPKVAPVLLAESED
Ga0207700_1004006413300025928Corn, Switchgrass And Miscanthus RhizosphereMKTILSVVPPTPEEQAPLVQVLIADSGPIQSQLLARALKGRREFEVATVDLDSSALHGFLQSNHADVVLIAGNHLADLSLLRWLRVSYPKIAPVLLVEADDRELVVNALRAGAKGIFLFTQTP
Ga0209871_101541723300026217Permafrost SoilMPAPSSATGIRARETEVVKVLVADSGPIQSQLLTRAFKSRRDFKVSAVALETAALRNFMQSNHVDVVLVAGNHLPDLTLLRWLRVSYPNVAPVLLAESDE
Ga0208995_103410213300027388Forest SoilMDTSGPSPFGHNSAVKIIRSAKQSTGTRPAATEAVHVLVADSGPIQSQLLTRALKSRRDFQVSAVALDTTALHNYLQSNRADVVLIAGNHLPDLSLLRWLRVSYPKIAPVLLAESDDREL
Ga0208324_102496933300027604Peatlands SoilMRSPKPAAINPTVETEIVQVVVADSSPIQSQLLTRALKSRRDFQVSAVALEASALHDFMQSNQADVVLIAGNHLADLSLLRWLRVSCPNIAPVLLAENDDRE
Ga0209905_106390413300027634Thawing PermafrostMGPTSGPGALGHNGSVKTVHPAKQPTGNESAGTEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVALETSALHNFMQSNRVDVVLIAENHLPDLSLLRWLRISYPKVVPILLAESDDRE
Ga0209011_100913043300027678Forest SoilMDTSGPSPFGHNSAVKIIRSAKQSTGTRPAATEAVHVLVADSGPIQSQLLTRALKSRRDFQVSAVALDTTALHNYLQSNRADVVLIAGNHLPDLSLLRWLRVSYPKIAPVLL
Ga0209011_117636913300027678Forest SoilMGHTFGPSPFGHNCGVKIIRSAKPSTGVRPAATEAVHVLVADSGPIQSQLLTRALKSRRDFQVSAVALDTTALHNFMQSNRADVVLIAGNHLPDLSLLRWLRVSYPKIAPVLLAE
Ga0209530_116485113300027692Forest SoilMNSERATKQKPTAESVPATSPSEIVQLLVADSGAIQSQLLTRALKSRKDFQVSAVALEISALHEFMQSNRADVVLVAANHLVDLSLLRWLRVSYPQAAPVLLVENDDR
Ga0209910_1004787813300027803Thawing PermafrostSSAAKMVHNRGPAKVDNNLPIRHQRGVMGPTYDPYALGHDGSVNTLRVTRQTRLSKPKPPAKTAPDVTEVVHVLVADSGPIQSQLLTRALKCRRDFQVSAVALEASALHKFLQSNQADVILIAGNHLPDLGLLRWLRLSYPKVAPLLLAESDDRELVVLSLIHI
Ga0209039_1023086623300027825Bog Forest SoilMRSTKQPTGTDSTRTEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVALETVALRNYMQSNHADVVLIAGNRLPDLGVLRWLRVSYPKIAPILLAESDDRELVVNAFRAGAKGIFLFAHTPFPML
Ga0209180_1035134213300027846Vadose Zone SoilMSAAKPSTGTPPVETETVQVLVADSGPIQSQLLTRALKSRREFQVSAVALQTSAVHNFMQSNHADVVLVAGNRLPDFSLLRWLRVSYPKVAPVLLAESDDRELVVNALRAGAKGIFLFTHTPFPMLCKCI
Ga0209415_1110710913300027905Peatlands SoilMRSAKLATGTPTVETEIVQVLVADSGLIQSQLLTRALKSRRDFQVSAVALETSALHNFLQSNNADVVLIAGNYLPDLSLLRWLRVSYPKIAPVLLAENDYRELVVNALRAG
Ga0255358_106414213300028069SoilMGPTSGPGALGHNGSVKTVHPAKQPTGNESAGTEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVALETSALHHFMQSNHADVVLIAGNHLPDLSLLRWLRVSYPKIVPI
Ga0308309_1009406333300028906SoilMRYTSGPYPLGHDQEVKISRSAKHPTVISQVVADTVHVLVADSGPIQSQLLTRALKNRRDFHVSAVALEMSALHSFMQSSPTDVVLIAGNHLPDFSLLRWLRVSYPKIAPILLAESDDRELVVNAFRAGAKGIFLFTHTPLPML
Ga0247275_104676613300029817SoilVKTIHLAKQSTGTPPAAIETVQVVVADSSPIQSQLLTRALKDRRDFQVSAVALETSALDHFLQSNHADVALVAGNHLPDLSLLRWLRVSYPKIAPVLLAENDDRELVVNALRAGAKGIFLFTHTPF
Ga0247271_10206973300029903SoilMAPTSGSSALGHDGSVNILRTTRQIPSKEAVTSTSEVVQLLVADSGAIQSQLLTRALKGRKDFQVSAVALEAAALHKFMQSNRADVVLIAGNHLPDLXXXXXXXX
Ga0311352_1029108933300029944PalsaVAFGQWIHHKDGVMVPTYGPCRLVHDDSMSILRTTKLSTAVPAVETEIVRVLVADSGPIQSQLLTRALKERRDLEVSAVALDGSALQDYMQSNSVDVVLIAGNHLKDFGLLRWLRVSHPGVATVLLTENDDRDLV
Ga0311371_1262074113300029951PalsaMIGGVKTTSYAKRSTEIRPAAAEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVPLEMSALHNFMQSNNADVILIAGNHLPDLSLLRWLRVTYPKIAPVLLAENEDRELVVNAL
Ga0302182_1011570813300030054PalsaMIGGVKTTSYAKRSTEIRPAAAEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVPLEMSALHNFMQSNNADVILIAGNHLPDLSLLRWLRVTYPKIAPVLLAENEDRE
Ga0302176_1014973933300030057PalsaMSILRTTKLSTAVPAVETEIVRVLVADSGPIQSQLLTRALKERRDLEVSAVALDGSALQDYMQSNSVDVVLIAGNHLKDFGLLRWLRVSHPGVAT
Ga0302183_1017399423300030509PalsaMIGGVKTTSYAKRSTEIRPAAAEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVPLEMSALHNFMQSNNADVILIAGNHLPDLSLLRWLRVTYPKIAPVLLAENEDRELVVNA
Ga0311357_1088960523300030524PalsaMGPTYGPHAFGHDKSVKTIHLAKPTSEPPRATTETVQIVVADSSPIQSQLLTRALKSRRDFQVSAVALETSALDKFMRSNHVDVVLVAGNHLPDLGVLRWLRVSYPKTAPVL
Ga0310038_1036848513300030707Peatlands SoilMRSPKLAARTPTVETEIVQVVVADSSPIQSQLLTRALKSRRDFQVSAVALEASALHDFLQSNQADVVLIAGNHLADLSLLRWLRVSYPNI
Ga0310038_1044121113300030707Peatlands SoilMRSVKPSTETGPAATEVVHVLVADSGPIQSQLLTRALKSRREFQVSAVALETSALHNFMQSNPADVVLLAGNHLPDLGLLRWLRVSYPRIAPVLLAESDDREVVVNALRAGAKGIFLFTH
Ga0265746_103193013300030815SoilMVADSGPIQSQLLTRALKNRRDFQVSAVALEMSALDSFMQSSQPDVVLIAGSHLPDFSLLRWLRVSYPKIAPILLAESDDRELVVNAFRAGA
Ga0265316_1101842123300031344RhizosphereVNTTRTTTPPTGTGSAAPEVVHVLIADSGPIQSELLTRALRARRDFRVSAVALEASALTNFLQSNPADVVLVAGNRLPDLSLLRWLRVSYPKIAPVLLAES
Ga0310686_10655374713300031708SoilMRITKQVADSPVIETETVQVLIADSGPIQSQLLTRALKGRRDFQVSAVALETSALEDYLQSNHADVVLIAGNHLPDLSLLRWLRVSYPQIAPVLLAENDDRELVVSALRAGAKGI
Ga0307475_1145198823300031754Hardwood Forest SoilVNSSQTGVMRHTSDPSPFGHNCGVKIIRSAKPSTGTRPAATEAVHVLVADSGPIQSQLLTRALKSRRDFQVSAVALDTTALHNYLQSNRADVVLIAGNHLPDLSL
Ga0334822_044030_160_5493300034070SoilMHATKQATGSHPVATEVVQVLVADSGPIQSQLLTRALKSRRDFQVSAVALETDALHNFMESNRADVVLIAGNHLPDLSLLRWLRVSHPKIAPVLLAETDDRELVVNAFRAGARGIFLFAHTPFFRERFG
Ga0370492_0037474_1_3213300034282Untreated Peat SoilVKVLVADSGPIQSQLLARALKARRDFHVSAVALETLALHDLMQSKPVDVVLIAGNHLPDLSLLRWLRVSYPKVAPVLLIESDDRELVVNALRAGAKGIFLFTHTPFS
Ga0370492_0463189_167_5143300034282Untreated Peat SoilMTPVPTEIIQVLVADSAPIQSQLLTRALKARRDFQVSACALEMPALDEVLQSTSPDVILIAANFQPDFSLVRWLRVSHPKIAPVLLIESDDRELVVSAMRAGAKGIFLFSQTPFTL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.