NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F103503

Metagenome Family F103503

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103503
Family Type Metagenome
Number of Sequences 101
Average Sequence Length 50 residues
Representative Sequence TERSSKHGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP
Number of Associated Samples 89
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 93.07 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.267 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(13.861 % of family members)
Environment Ontology (ENVO) Unclassified
(56.436 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(53.465 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF07759DUF1615 26.73
PF13560HTH_31 24.75
PF01042Ribonuc_L-PSP 4.95
PF00106adh_short 2.97
PF02780Transketolase_C 1.98
PF13343SBP_bac_6 1.98
PF00561Abhydrolase_1 0.99
PF03009GDPD 0.99
PF01261AP_endonuc_2 0.99
PF01970TctA 0.99
PF01638HxlR 0.99
PF07969Amidohydro_3 0.99
PF08668HDOD 0.99
PF07908Obsolete Pfam Family 0.99
PF13280WYL 0.99
PF00135COesterase 0.99
PF00440TetR_N 0.99
PF00793DAHP_synth_1 0.99
PF07287AtuA 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 4.95
COG0584Glycerophosphoryl diester phosphodiesteraseLipid transport and metabolism [I] 0.99
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.99
COG1784TctA family transporterGeneral function prediction only [R] 0.99
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.99
COG3333TctA family transporterGeneral function prediction only [R] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.27 %
UnclassifiedrootN/A26.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_107948032All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300000956|JGI10216J12902_109459406Not Available777Open in IMG/M
3300003991|Ga0055461_10145224Not Available622Open in IMG/M
3300004282|Ga0066599_100778946All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300005328|Ga0070676_11340093Not Available548Open in IMG/M
3300005330|Ga0070690_100877002All Organisms → cellular organisms → Bacteria → Proteobacteria700Open in IMG/M
3300005331|Ga0070670_100140692All Organisms → cellular organisms → Bacteria → Proteobacteria2086Open in IMG/M
3300005331|Ga0070670_101973561Not Available538Open in IMG/M
3300005333|Ga0070677_10029134All Organisms → cellular organisms → Bacteria → Proteobacteria2091Open in IMG/M
3300005333|Ga0070677_10769533All Organisms → cellular organisms → Bacteria → Proteobacteria547Open in IMG/M
3300005334|Ga0068869_101902631All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium533Open in IMG/M
3300005338|Ga0068868_102155213All Organisms → cellular organisms → Bacteria → Proteobacteria531Open in IMG/M
3300005356|Ga0070674_101006241All Organisms → cellular organisms → Bacteria → Proteobacteria732Open in IMG/M
3300005455|Ga0070663_101003979All Organisms → cellular organisms → Bacteria → Proteobacteria726Open in IMG/M
3300005456|Ga0070678_100469074All Organisms → cellular organisms → Bacteria → Proteobacteria1106Open in IMG/M
3300005456|Ga0070678_100900881All Organisms → cellular organisms → Bacteria → Proteobacteria808Open in IMG/M
3300005456|Ga0070678_102153477All Organisms → cellular organisms → Bacteria → Proteobacteria529Open in IMG/M
3300005457|Ga0070662_101886629All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300005459|Ga0068867_101018885All Organisms → cellular organisms → Bacteria → Proteobacteria752Open in IMG/M
3300005539|Ga0068853_100753640All Organisms → cellular organisms → Bacteria → Proteobacteria931Open in IMG/M
3300005543|Ga0070672_100172259All Organisms → cellular organisms → Bacteria1800Open in IMG/M
3300005548|Ga0070665_102051883Not Available577Open in IMG/M
3300005617|Ga0068859_102288474All Organisms → cellular organisms → Bacteria → Proteobacteria596Open in IMG/M
3300005618|Ga0068864_100036594All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4184Open in IMG/M
3300005660|Ga0073904_10241527Not Available1042Open in IMG/M
3300006224|Ga0079037_102386899All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria528Open in IMG/M
3300006237|Ga0097621_101635718All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300006755|Ga0079222_12537401Not Available515Open in IMG/M
3300009078|Ga0105106_11043903All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium581Open in IMG/M
3300009098|Ga0105245_10036022All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales4393Open in IMG/M
3300009177|Ga0105248_10232571All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2075Open in IMG/M
3300009177|Ga0105248_11843333All Organisms → cellular organisms → Bacteria → Proteobacteria686Open in IMG/M
3300011119|Ga0105246_10835680All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300012043|Ga0136631_10489899Not Available504Open in IMG/M
3300012046|Ga0136634_10435274Not Available551Open in IMG/M
3300012511|Ga0157332_1070288Not Available544Open in IMG/M
3300012526|Ga0136637_1115378Not Available929Open in IMG/M
3300012684|Ga0136614_10804822All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium656Open in IMG/M
3300012958|Ga0164299_10284366All Organisms → cellular organisms → Bacteria → Proteobacteria1007Open in IMG/M
3300012958|Ga0164299_10833677All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300014325|Ga0163163_10482432All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1301Open in IMG/M
3300014326|Ga0157380_11769639All Organisms → cellular organisms → Bacteria → Proteobacteria677Open in IMG/M
3300014745|Ga0157377_10941044All Organisms → cellular organisms → Bacteria → Proteobacteria649Open in IMG/M
3300014866|Ga0180090_1083437All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae571Open in IMG/M
3300014969|Ga0157376_11057066All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300015373|Ga0132257_102230476All Organisms → cellular organisms → Bacteria → Proteobacteria709Open in IMG/M
3300015374|Ga0132255_105728280All Organisms → cellular organisms → Bacteria → Proteobacteria526Open in IMG/M
3300017695|Ga0180121_10429010Not Available516Open in IMG/M
3300017787|Ga0183260_10617296Not Available694Open in IMG/M
3300017792|Ga0163161_10882435All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300017965|Ga0190266_10278040All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300018476|Ga0190274_11499871All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300018920|Ga0190273_11629937Not Available578Open in IMG/M
3300019142|Ga0193597_1151703Not Available690Open in IMG/M
3300020157|Ga0194049_1028278All Organisms → cellular organisms → Bacteria → Proteobacteria1448Open in IMG/M
3300020192|Ga0163147_10493924All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae580Open in IMG/M
3300021601|Ga0194061_1152437Not Available689Open in IMG/M
3300022204|Ga0224496_10107910All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1210Open in IMG/M
3300025271|Ga0207666_1058254All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300025321|Ga0207656_10711827All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → Collimonas fungivorans514Open in IMG/M
3300025904|Ga0207647_10784273Not Available514Open in IMG/M
3300025909|Ga0207705_10999931All Organisms → cellular organisms → Bacteria → Proteobacteria646Open in IMG/M
3300025920|Ga0207649_10487937All Organisms → cellular organisms → Bacteria → Proteobacteria935Open in IMG/M
3300025925|Ga0207650_11267562All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300025925|Ga0207650_11357462All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300025932|Ga0207690_10591194All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300025933|Ga0207706_10225263All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1641Open in IMG/M
3300025936|Ga0207670_10332575All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. Leaf4001198Open in IMG/M
3300025937|Ga0207669_10751235All Organisms → cellular organisms → Bacteria → Proteobacteria805Open in IMG/M
3300025938|Ga0207704_11225783Not Available640Open in IMG/M
3300025940|Ga0207691_10922423All Organisms → cellular organisms → Bacteria → Proteobacteria730Open in IMG/M
3300025940|Ga0207691_11167816Not Available639Open in IMG/M
3300026023|Ga0207677_10915198All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300026023|Ga0207677_11842028All Organisms → cellular organisms → Bacteria → Proteobacteria562Open in IMG/M
3300026067|Ga0207678_11970613All Organisms → cellular organisms → Bacteria → Proteobacteria509Open in IMG/M
3300027979|Ga0209705_10626134All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium512Open in IMG/M
3300028381|Ga0268264_11150357All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300028587|Ga0247828_10336785Not Available846Open in IMG/M
3300028592|Ga0247822_11600122All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → Collimonas fungivorans552Open in IMG/M
3300028596|Ga0247821_11269401All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300028597|Ga0247820_10702408All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300028608|Ga0247819_10625188Not Available651Open in IMG/M
3300028812|Ga0247825_10739392Not Available709Open in IMG/M
3300028812|Ga0247825_10764016All Organisms → cellular organisms → Bacteria → Proteobacteria697Open in IMG/M
3300028889|Ga0247827_11237209Not Available519Open in IMG/M
3300030336|Ga0247826_10293982All Organisms → cellular organisms → Bacteria → Proteobacteria1161Open in IMG/M
3300031538|Ga0310888_10214125All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300031548|Ga0307408_101452411All Organisms → cellular organisms → Bacteria → Proteobacteria647Open in IMG/M
3300031731|Ga0307405_10068184All Organisms → cellular organisms → Bacteria → Proteobacteria2276Open in IMG/M
3300031731|Ga0307405_11087007Not Available687Open in IMG/M
3300031740|Ga0307468_101062075Not Available718Open in IMG/M
3300031852|Ga0307410_11211501All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquincola → unclassified Aquincola → Aquincola sp. J276658Open in IMG/M
3300032002|Ga0307416_102368338All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium631Open in IMG/M
3300032012|Ga0310902_10287014All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. Leaf4001008Open in IMG/M
3300032074|Ga0308173_12052665All Organisms → cellular organisms → Bacteria → Proteobacteria539Open in IMG/M
3300032126|Ga0307415_101405215Not Available665Open in IMG/M
3300033413|Ga0316603_12112458All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium532Open in IMG/M
3300033483|Ga0316629_10048310All Organisms → cellular organisms → Bacteria → Proteobacteria2107Open in IMG/M
3300033550|Ga0247829_10126448All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp.1963Open in IMG/M
3300033551|Ga0247830_10659377Not Available830Open in IMG/M
3300034128|Ga0370490_0331429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil13.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere7.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere6.93%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand5.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.94%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere5.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.95%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere2.97%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.98%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.98%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.99%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.99%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.99%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.99%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.99%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.99%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.99%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003991Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005660Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitateEngineeredOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012046Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06)EnvironmentalOpen in IMG/M
3300012511Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10EnvironmentalOpen in IMG/M
3300012526Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ857 (21.06)EnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014866Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10DEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017695Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)EnvironmentalOpen in IMG/M
3300017787Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019142Soil crust microbial communities from Colorado Plateau, Utah, USA - mid late stage, 3 min after wetting v1EnvironmentalOpen in IMG/M
3300020157Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25mEnvironmentalOpen in IMG/M
3300020192Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1EnvironmentalOpen in IMG/M
3300021601Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L224-21mEnvironmentalOpen in IMG/M
3300022204Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1EnvironmentalOpen in IMG/M
3300025271Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034128Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10794803213300000956SoilIEPELMQKTMDITFANAKPDKPIAVNEVFTNQFSSKVKP*
JGI10216J12902_10945940623300000956SoilGWIEPELMQKTMDITFANAKPDKPVALNDVFTNQFSSKVKP*
Ga0055461_1014522423300003991Natural And Restored WetlandsLGWIEPELMQKTMDITFANNKPEKALAVNDVFTNQYSSRIKP*
Ga0066599_10077894623300004282FreshwaterLCVTERSSKHGLGWIEPELMQKTMDITFATTKPDKPMVLADVFTNEYSSRIKP*
Ga0070676_1134009323300005328Miscanthus RhizosphereSKHGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP*
Ga0070690_10087700223300005330Switchgrass RhizosphereTERSSKYGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNDYNSRIKP*
Ga0070670_10014069243300005331Switchgrass RhizosphereVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYNSRIKP*
Ga0070670_10197356123300005331Switchgrass RhizosphereGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP*
Ga0070677_1002913413300005333Miscanthus RhizosphereATMPAILDLCVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP*
Ga0070677_1076953313300005333Miscanthus RhizosphereATMPAILDLCVTERSSKHGLGWIEPELMQKTMDITFATAKSDKPMVLADVFTNEYSSRIKP*
Ga0068869_10190263113300005334Miscanthus RhizosphereRSAKHGMGWIEPELMQKTMDITFANAKPDKPVAVNDVFTNQFSSKVKP*
Ga0068868_10215521323300005338Miscanthus RhizosphereGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNDYSSRIKP*
Ga0070674_10100624113300005356Miscanthus RhizosphereYGLGWMEPELMQKTMEITFATAKPDKPIVLSEVFTNEYSSRIKP*
Ga0070663_10100397923300005455Corn RhizosphereEPELMQKTMDITFATAKPDKPMALADVFTNDYSSRIAVIAALP*
Ga0070678_10046907423300005456Miscanthus RhizosphereMPAILDLCVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYNSRIKP*
Ga0070678_10090088113300005456Miscanthus RhizosphereVTERSSKHGLGWIEPELMQKTMDITFANAKPDRPMVLADVFTNEYSSRVKP*
Ga0070678_10215347713300005456Miscanthus RhizosphereLCVTERSAKNGLGWIETDLMQKTMDITFATAKPEKPLAVADVFTNQFSSKIKP*
Ga0070662_10188662913300005457Corn RhizosphereLDLCVTERSSKYGLGWMEPELMQKTMEITFATAKPDKPIVLSEVFTNEYSSRIKP*
Ga0068867_10101888513300005459Miscanthus RhizosphereKNGLGWIETDLMQKTMDITFASAKPEKPLAVADVFTNQFSSQVKP*
Ga0068853_10075364023300005539Corn RhizosphereIEPELMQKTIDITFATTKPDKPMVLADVFTNDYNSRIKP*
Ga0070672_10017225913300005543Miscanthus RhizosphereTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYSSRIKP*
Ga0070665_10205188323300005548Switchgrass RhizosphereYGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYSSRIKP*
Ga0068859_10228847423300005617Switchgrass RhizosphereGLGWIEPELMQKTIDITFATTKPDKPMVLADVFTNDYNSRIKP*
Ga0068864_10003659413300005618Switchgrass RhizosphereMQKTMDITFATAKPDKPMVLADVFTNEYSSRIKP*
Ga0073904_1024152723300005660Activated SludgeAKHGLGWIEPELMQKTMEITFANAKPDKAFAAADAFTNEFSSRIKP*
Ga0079037_10238689913300006224Freshwater WetlandsTLLATMPQILDLCVTERSAKNGLGWIEPELMQKTMEITFANAKPDKAFAAADAFTNQFSSRIKP*
Ga0097621_10163571813300006237Miscanthus RhizosphereCVTERSSKYGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP*
Ga0079222_1253740113300006755Agricultural SoilELMQKTMDITFASNKPERPVELKDVFTNEFNSRIKP*
Ga0105106_1104390313300009078Freshwater SedimentGLGWIEPELMQKTMDITFANTKPDKAFAAADAFTNQFNSRIKP*
Ga0105245_1003602213300009098Miscanthus RhizosphereLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP*
Ga0105248_1023257113300009177Switchgrass RhizosphereTERSSKYGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP*
Ga0105248_1184333323300009177Switchgrass RhizosphereDLCVTERSSKYGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNDYNSRIKP*
Ga0105246_1083568013300011119Miscanthus RhizosphereMPAILDLCVTERSSKYGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP*
Ga0136631_1048989923300012043Polar Desert SandCVTERSAKHGLGWIEPELMQKTMDITFSNAKPEKPLAVADVFTNQFSSRIKP*
Ga0136634_1043527413300012046Polar Desert SandTMPQILDLTVTDRSRKHGLGWMEPELMQKTIDITFGSNKPERPLNVADVFTNEFSSKIKP
Ga0157332_107028813300012511SoilLATMPAILDLCVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP*
Ga0136637_111537813300012526Polar Desert SandTLLATMPQILDLTVTERSAKHGLGWIEPELMQKTMDITFATNKPDKPLVLNDTFTNQFSSKIKP*
Ga0136614_1080482213300012684Polar Desert SandLDLTVTDRSRKHGLGWMEPELMQKTIDITFAGNKPERPMNVADVFTNEFSSKIKPTK*
Ga0164299_1028436613300012958SoilTMPAILDLCVTERSSKYGLGWIEPELMQKTIDITFATAKPDKPMVLADVFTNEYSSRIKP
Ga0164299_1083367713300012958SoilTLLATMPAILDLCVTERSSKYGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYSSRIKP*
Ga0163163_1048243233300014325Switchgrass RhizosphereYGLGWIEPELMQKTMDITFATARPDKPMVLADVFSNEYSSRIKP*
Ga0157380_1176963913300014326Switchgrass RhizosphereLGWIEPELMQKTMDITFATAKPDKQMVLADEFTKEYSSRIKP*
Ga0157377_1094104413300014745Miscanthus RhizosphereCVTERSSKYGLGWMEPELMQKTMEITFATAKPDKPIVLSEVFTNEYSSRIKP*
Ga0180090_108343713300014866SoilELMQKTMDITFASAKPEKPLAVADVFTNQFSSKIRP*
Ga0157376_1105706613300014969Miscanthus RhizosphereTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP*
Ga0132257_10223047623300015373Arabidopsis RhizosphereGLGWIEPELMQKTMDITFATAKPDKPMALSEVFTNDYNSRIKP*
Ga0132255_10572828023300015374Arabidopsis RhizosphereCVTERSSKYGLGWIEPELMQKTMDVTFATAKPDKPMVLVDVFTNDYNSRIKP*
Ga0180121_1042901023300017695Polar Desert SandLTVTDRSRKHGLGWMEAELMQKTMDITFASNKPERPMNVADVFTNEFSSKIKPTK
Ga0183260_1061729623300017787Polar Desert SandLGWIEPELMQKTMDITFGNNNPDKPMVLNDVFTNEFNSRIKP
Ga0163161_1088243523300017792Switchgrass RhizosphereWIEPELMQKTMDITFATAKPDKPMVLADVFTNDYSSRIKP
Ga0190266_1027804023300017965SoilSSKHGLGWIEPELMQKTMDITFATAKPDKPMVLADVFSNEYSSRIKP
Ga0190274_1149987123300018476SoilCVTERSSKHGLGWIEPELMQKTMDITFATNKPDKPLVLSEVFTNEYSSRIKP
Ga0190273_1162993713300018920SoilTMPQILDLCVTERSSRHGMGWIEPELMQKTMEITFASSKPEKPVALEDVFTNDFSSRIRP
Ga0193597_115170313300019142SoilTTLLATMPQILDLCVTERSTKHGLGWIEPELMQKTMDITFATNKPDKALAVNDVFTNQFSSKIKP
Ga0194049_102827833300020157Anoxic Zone FreshwaterRSRKHGIGWIEPELMAKTLEITFANTKPDKPVKSEDVFTNAYNSRIKPLK
Ga0163147_1049392423300020192Freshwater Microbial MatGWIETELMQKTMDITFASAKPEKPLAVADVFTNQFSSKIKP
Ga0194061_115243723300021601Anoxic Zone FreshwaterLATMPQILDLCITDRSRKHGIGWIEPELMAKTLEITFANTKPDKPVKSEDVFTNAYNSRIKPLK
Ga0224496_1010791013300022204SedimentLGWIEPELMQKTMDITFANAKPEKPLSVADVFTNEFSSRIKP
Ga0207666_105825413300025271Corn, Switchgrass And Miscanthus RhizosphereMPAILDLCVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTND
Ga0207656_1071182723300025321Corn RhizospherePTLLATMPQILDLCVTERSTKNGLGWIETDLMQKTMDITFATAKPEKPLAVADVFTNQFSSKIKP
Ga0207647_1078427323300025904Corn RhizosphereGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP
Ga0207705_1099993123300025909Corn RhizosphereATLLATMPAILDLCVTERSAKHGLGWIEPELMQKTIDITFATTKPDKPMVLADVFTNDYNSRIKP
Ga0207649_1048793723300025920Corn RhizospherePELMQKTIDITFATAKPDKPLALADVFTNEYSSRIKP
Ga0207650_1126756213300025925Switchgrass RhizosphereCVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYNSRIKP
Ga0207650_1135746213300025925Switchgrass RhizosphereLMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP
Ga0207690_1059119413300025932Corn RhizosphereTLLATMPAILDLCVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPIVLSEVFTNEYSSRIKP
Ga0207706_1022526333300025933Corn RhizosphereILDLCVTERSSKHGLGWIEPELMQKTIDITFATTKPDKPMVLADVFTNDYNSRIKP
Ga0207670_1033257533300025936Switchgrass RhizosphereKYGMGWIETELMQKTMDITFANAKPEKALAVADVFTNQFSSKVKP
Ga0207669_1075123523300025937Miscanthus RhizosphereTMPAILDLCVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYSSRIKP
Ga0207704_1122578313300025938Miscanthus RhizosphereAILDLCVTERSSKHGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP
Ga0207691_1092242323300025940Miscanthus RhizosphereRSSKHGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYSSRIKP
Ga0207691_1116781613300025940Miscanthus RhizosphereRSSKHGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP
Ga0207677_1091519813300026023Miscanthus RhizosphereWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP
Ga0207677_1184202813300026023Miscanthus RhizosphereMPAILDLCVTERSAKHGLGWIEPELMQKTIDVTFATTKPEKPLTLADVFTNEFNSRIKP
Ga0207678_1197061313300026067Corn RhizospherePELMQKTMDITFATAKPDKPMALADVFTNDYSSRIKP
Ga0209705_1062613413300027979Freshwater SedimentRSAKHGLGWIEPELMQKTMDITFANTKPDKAFAAADAFTNQFNSRIKP
Ga0268264_1115035713300028381Switchgrass RhizosphereEPELMQKTMDITFATAKPDKPMVLADVFTNEYSSRIKP
Ga0247828_1033678523300028587SoilLATMPAILDLCVTERSAKHGLGWIEPELMQKTMDITFATAKPEKPMVLADVFTNEYSSRIKP
Ga0247822_1160012213300028592SoilETDLMQKTMDITFASAKPEKPLAVADVFTNQFSSQVKP
Ga0247821_1126940113300028596SoilIEPELMQKTMDITFATAKPDKPMVLADVFSNEYSSRIKP
Ga0247820_1070240823300028597SoilSKYGLGWIEPELMQKTMDITFATAKPDKPMALADVFTNEYSSRIKP
Ga0247819_1062518823300028608SoilMPQILDLCVTERSAKHGLGWIEPELMQKTMDITFASNKPERAVELKDVFTNDFNSRIKP
Ga0247825_1073939213300028812SoilTMPQILDLCVTERSAKHGLGWIEPELMQKTMDITFASNKPERPVDVKDVFTNEFNSRIKP
Ga0247825_1076401623300028812SoilGWIEPELMQKTIDVTFATTKPEKPLTLADVFTNEFNSRIKP
Ga0247827_1123720923300028889SoilTERSAKHGLGWIEPELMQKTMDITFASNKPERSVDVKDVFTNDFNSRIKP
Ga0247826_1029398213300030336SoilPELMQKTMDITFATAKPDKPMVLADVFTNEYSSRIKP
Ga0310888_1021412523300031538SoilATMPQILDLCVTERSAKHGMGWIEPELMQKTMDITFANAKPDKPVAVNDVFTNQFSSKVK
Ga0307408_10145241123300031548RhizosphereERSAKHGMGWIEPELMQKTMDITFATAKPDKPMTLADVFTNEYNSRIKP
Ga0307405_1006818413300031731RhizosphereTERSAKHGLGWIEPELMQKTMDITFASAKPDKPLNVNDVFTNQFNSKIKP
Ga0307405_1108700723300031731RhizosphereGLGWIEPELMQKTMDITFASNKPEKPLVLNDTFTNQFSSKIKP
Ga0307468_10106207523300031740Hardwood Forest SoilILDLCVTERSSKYGLGWIEPELMQKTMDITFATAKPDKPMVLADVFTNEYNSRIKP
Ga0307410_1121150123300031852RhizosphereLCVTERSAKHGMGWIEPELMQKTMDITFANNKPEKPVAVNDVFTNQFSSKVKP
Ga0307416_10236833823300032002RhizosphereLATMPQILDLCVTERSAKHGLGWIEPELMQKTMDITFANAKPDKPLNVNDVFTNQFNSKIKP
Ga0310902_1028701433300032012SoilTERSAKNGLGWIEADLMQKTMDITFASAKPEKPLAVADVFTNQFSSKIRP
Ga0308173_1205266523300032074SoilKHGLGWIEPELMQKTIDITFATTKPDKPLVLADVFTNEYSSRIKP
Ga0307415_10140521513300032126RhizosphereATLLATMPQILDLCVTERSAKHGLGWIDQELMQKTMDITFASNKPEKPLVLNDTFTNQFSSKIKP
Ga0316603_1211245813300033413SoilAKHGLGWIEPELMQKTMDITFANAKPDKAFAAADAFTNQFSSRIKP
Ga0316629_1004831033300033483SoilPELMQKTMDITFANAKPDKAFAVADAFTNQFSSRIKP
Ga0247829_1012644813300033550SoilLMQKTMDITFASAKPEKPLAVADVFTNQFSSQVKP
Ga0247830_1065937713300033551SoilATLLATMPQILDLCVTERSAKHGMGWIEPELMQKTMDITFANAKPEKPVALNDVFTNQFSSKVKP
Ga0370490_0331429_2_1753300034128Untreated Peat SoilQILDLCVTERSAKHGLGWIEPELMQKTMDITFATNKPEKAVAVNDVFTNQYNSKIKP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.