NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103352

Metagenome / Metatranscriptome Family F103352

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103352
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 189 residues
Representative Sequence MKFVVAALIGVISAAQVSEFSDLAPHSYIEAPVSLVQQAAESESESSESDDEEVQTQFDTIPVGYDGAHFYERQIPERFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAREVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Number of Associated Samples 91
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 91.09 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(50.495 % of family members)
Environment Ontology (ENVO) Unclassified
(80.198 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(85.149 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 50.78%    β-sheet: 6.22%    Coil/Unstructured: 43.01%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006357|Ga0075502_1462956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300006384|Ga0075516_1238122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium629Open in IMG/M
3300006400|Ga0075503_1372569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium696Open in IMG/M
3300006402|Ga0075511_1523110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium721Open in IMG/M
3300006403|Ga0075514_1486391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium740Open in IMG/M
3300006405|Ga0075510_10650459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium703Open in IMG/M
3300008993|Ga0104258_1066689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300009077|Ga0115552_1190824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium844Open in IMG/M
3300009436|Ga0115008_10786636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium696Open in IMG/M
3300009437|Ga0115556_1239027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300009476|Ga0115555_1238124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium742Open in IMG/M
3300009599|Ga0115103_1007475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300009599|Ga0115103_1892905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium632Open in IMG/M
3300009606|Ga0115102_10530710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium722Open in IMG/M
3300009608|Ga0115100_10561255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium600Open in IMG/M
3300012470|Ga0129329_1051493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium653Open in IMG/M
3300012472|Ga0129328_1064847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300012523|Ga0129350_1232997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300012523|Ga0129350_1327316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300012524|Ga0129331_1381393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300012525|Ga0129353_1692881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300012528|Ga0129352_10087416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300012969|Ga0129332_1186012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300013010|Ga0129327_10446987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300018515|Ga0192960_106347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium563Open in IMG/M
3300018649|Ga0192969_1033976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium781Open in IMG/M
3300018684|Ga0192983_1031144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium733Open in IMG/M
3300018692|Ga0192944_1034899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium729Open in IMG/M
3300018730|Ga0192967_1044674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium742Open in IMG/M
3300018762|Ga0192963_1052062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300018766|Ga0193181_1039002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium691Open in IMG/M
3300018791|Ga0192950_1058735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium575Open in IMG/M
3300018800|Ga0193306_1050296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium635Open in IMG/M
3300018812|Ga0192829_1073983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300018823|Ga0193053_1058804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium617Open in IMG/M
3300018823|Ga0193053_1058985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300018831|Ga0192949_1079540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium638Open in IMG/M
3300018838|Ga0193302_1063865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300018846|Ga0193253_1101447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300018846|Ga0193253_1106051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium649Open in IMG/M
3300018848|Ga0192970_1068107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300018885|Ga0193311_10038469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300018885|Ga0193311_10039668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium679Open in IMG/M
3300018885|Ga0193311_10039920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300018899|Ga0193090_1104713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium643Open in IMG/M
3300018926|Ga0192989_10118307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium659Open in IMG/M
3300018926|Ga0192989_10126962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300018967|Ga0193178_10040279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300018976|Ga0193254_10109496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300018977|Ga0193353_10250895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300018979|Ga0193540_10117292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium743Open in IMG/M
3300018979|Ga0193540_10155422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300018979|Ga0193540_10180236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300018980|Ga0192961_10143838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium726Open in IMG/M
3300018981|Ga0192968_10106590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium745Open in IMG/M
3300018982|Ga0192947_10196229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300018989|Ga0193030_10206657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300019017|Ga0193569_10287794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300019021|Ga0192982_10188638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium732Open in IMG/M
3300019022|Ga0192951_10142032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium838Open in IMG/M
3300019022|Ga0192951_10203237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium726Open in IMG/M
3300019025|Ga0193545_10090582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300019036|Ga0192945_10122508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium829Open in IMG/M
3300019045|Ga0193336_10445332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300019048|Ga0192981_10236080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium704Open in IMG/M
3300019050|Ga0192966_10179088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium757Open in IMG/M
3300019051|Ga0192826_10220718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300019095|Ga0188866_1022310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300019108|Ga0192972_1075089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300019125|Ga0193104_1030814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium740Open in IMG/M
3300019149|Ga0188870_10153897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium517Open in IMG/M
3300019150|Ga0194244_10067297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300019153|Ga0192975_10216668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300021169|Ga0206687_1818908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300021350|Ga0206692_1872336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300021908|Ga0063135_1054052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium640Open in IMG/M
3300021912|Ga0063133_1087202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300023679|Ga0232113_1026817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300023704|Ga0228684_1044295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300025690|Ga0209505_1109930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium774Open in IMG/M
3300026470|Ga0247599_1089518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300026495|Ga0247571_1075715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium773Open in IMG/M
3300026500|Ga0247592_1104832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium681Open in IMG/M
3300026503|Ga0247605_1129250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300026513|Ga0247590_1118416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium683Open in IMG/M
3300028334|Ga0247597_1043747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium603Open in IMG/M
3300030670|Ga0307401_10548729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300030699|Ga0307398_10493692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium675Open in IMG/M
3300031038|Ga0073986_11971675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300031062|Ga0073989_13333585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium567Open in IMG/M
3300031674|Ga0307393_1134476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300031742|Ga0307395_10357546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300032521|Ga0314680_10927567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300032540|Ga0314682_10608227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300032617|Ga0314683_10679853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium629Open in IMG/M
3300032707|Ga0314687_10489293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium685Open in IMG/M
3300032708|Ga0314669_10518888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium656Open in IMG/M
3300032711|Ga0314681_10568983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300032745|Ga0314704_10642042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300032748|Ga0314713_10452481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300032750|Ga0314708_10410332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium661Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine50.50%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous13.86%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine8.91%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater8.91%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater7.92%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.96%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.98%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.98%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.99%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006405Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012470Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0075502_146295613300006357AqueousLIGAVSATKIEEFSTIAPHSYIETPFNPDYIQQESESESSDSEEDEALQTTADARFDTFPVAYDGTHFYERVITPRFSADTDDLFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLATHKGLTGAALDQYIATFFEKTWGHFDVNKTGWIEVIKMPQF
Ga0075516_123812213300006384AqueousMKFAVALLIGAVSATKIEEFSTIAPHSYIETPFNPDYIQQESESESSDSEEDEALQTTADARFDTFPVAYDGTHFYERVITPRFSADTDDLFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLATHKGLTGAALDQYIATFFEKTWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG*
Ga0075503_137256913300006400AqueousFAVALLIGAVSATKIEEFSTIAPHSYIETPFNPDYIQQESESESSDSEEDEALQTTADARFDTFPVAYDGTHFYERVITPRFSADTDDLFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLATHKGLTGAALDQYIATFFEKTWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG*
Ga0075511_152311013300006402AqueousFAVALLIGAVSATKIEEFSTIAPHSYIETPFNPDYIQQESESESSDSEEDEALQTTADARFDTFPVAYDGTHFYEIVITPRFSADTDDLFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLATHKGLTGAALDQYIATFFEKTWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG*
Ga0075514_148639113300006403AqueousKFAVALLIGAVSATKIEEFSTIAPHSYIETPFNPDYIQQESESESSDSEEDEALQTTADARFDTFPVAYDGTHFYERVITPRFSADTDDLFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLATHKGLTGAALDQYIATFFEKTWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG*
Ga0075510_1065045913300006405AqueousLLIGAVSATKIEEFSTIAPHSYIETPFNPDYIQQESESESSDSEEDEALQTTADARFDTFPVAYDGTHFYERVITPRFSADTDDLFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLATHKGLTGAALDQYIATFFEKTWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG*
Ga0104258_106668913300008993Ocean WaterVAVLIGAVAATKIEEFSTIAPHSYIETPFNPDYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG*
Ga0115552_119082413300009077Pelagic MarineMKFAVAVLIGAVAATKIEEFSTIAPHSYIETPFNPNYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG*
Ga0115008_1078663613300009436MarineTIAPHSYIETPFNPDYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG*
Ga0115556_123902713300009437Pelagic MarineIAPHSYIETPFNPNYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG*
Ga0115555_123812413300009476Pelagic MarineMKFAVAVLIGAVAATKIEEFSTIAPHSYIETPFNPNYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG*
Ga0115103_100747513300009599MarineMKFAVAVLIGAVAATKIEEFSTIAPHSYIETPFNPDYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVIKMPQ
Ga0115103_189290513300009599MarineMKFAVALLIGAVSATKVEEFSTIAPHSYIEKPFNPNYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERVITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLATHKGLGGAALDQYVATFFDKSWGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG*
Ga0115102_1053071013300009606MarineIKMKFAVAVLIGAVAATKIEEFSTIAPHSYIETPFNPDYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG*
Ga0115100_1056125513300009608MarineVVAALIGVISAGEVSEFKDLAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTPRFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSAAREVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG*
Ga0129329_105149313300012470AqueousKFAVAVLIGAVAATKIEEFSTIAPHSYIETPFNPDYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG*
Ga0129328_106484713300012472AqueousKMKFAVAVLIGAVAATKIEEFSTIAPHSYIETPFNPDYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG*
Ga0129350_123299713300012523AqueousEFSDLAPHSYIESPYNLVQQAAESESESSESDDEDVQTQFDTIPVGYDGAHFYERKIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAREVLNTHKGLAGGALDQYIATFFDKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG*
Ga0129350_132731613300012523AqueousGAVSATKIEEFSTIAPHSYIETPFNPDYIQQESESDSSDSEEDEAVQTTADARFDTFPVAYDGTHFYERVITPRFSADTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLATHKGLGGAALDQYIATFFDKSWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG*
Ga0129331_138139313300012524AqueousYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG*
Ga0129353_169288113300012525AqueousMKFVVAALLGVISAAQVSEFSDLAPHSYIESPYNLVQQAAESESESSESDDEDVQTQFDTIPVGYDGAHFYERKIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAREVLNTHKGLAGGALDQYIATFFDKAWGHFDVNKTG
Ga0129352_1008741613300012528AqueousKFVVAALLGGISAAQVSEFSDLAPHSYIESPYNLVQQAAESESESSESDDEDVQTQFDTIPVGYDGAHFYERKIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAREVLNTHKGLAGGALDQYIATFFDKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG*
Ga0129332_118601213300012969AqueousMKFAVAVLIGAVAATKIEEFSTIAPHSYIETPFNPDYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG*
Ga0129327_1044698713300013010Freshwater To Marine Saline GradientLIGAVAATKIEEFSTIAPHSYIETPFNPDYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG*
Ga0192960_10634713300018515MarineEESESESSDDEEVQTQFDTIPVGYDGAHFYERQIPERFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKSGGEPTGKFWMNKEDALSAAKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192969_103397613300018649MarineHGELYKIIKLKMKFVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFSRFLASDQWMSLKESGXASGSQKDVNRTLISANANSDNISHENFI
Ga0192983_103114413300018684MarineMGKIIKLKMKFVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFSRFLASDQWMSLKESG
Ga0192944_103489913300018692MarineMGKINKLKMKFVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEVQTQFDTIPVGYDGAHFYERQIPERFSKDTDDIFMRSMITAYAHEEKSKVEEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192967_104467413300018730MarineMGKIIKLKMKFVFAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFSRFLASDQWMSLKESGXASGSQKDVNRTLISANANSDNISHENFI
Ga0192963_105206213300018762MarineLKMKFVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFSRFLASDQWMSLKESG
Ga0193181_103900213300018766MarineMKFVVAALIGVISATEVSQFKDLAPHSYIPSPYSLVQENEGSESESSESDDEDVQTQFDTIPVGYDGAHFYERKIPDRFSKDTDDIFMRSMITAYAHEEKSKVEEHDDGTKTGGEPTGRFWMNKDDATSAAREVLNTHKGLSGAALDQYIATFFDKAWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192950_105873513300018791MarineNAGTQVDYAGYSADRANARGPYDHSFVQNQESESESSDSDDSGDEDIQTKFDTFPIGLDGSQFYERKVTERFSQDTDDIFMRSMIAQYAHEEKSEVKEHDNGTKSGGEPTGKFWMNQGDALLAAKEVLATHKGLTGTALEQYLTTFFAKSWGHFDVNQTGWIEVIKMPQFCRFLPPTNTMSLKESG
Ga0193306_105029613300018800MarineFVVALLLGVISATKVSDFSSLAPHSYIENPNNLVQQAVESESESSDSEEEDVQTGVDSKFDTFPVAYDGAHFYERVIPDRFSKDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKSGGEPTGRFWMNKEDALSAAKEVLGTHKGLAGGALDQYIATFFEKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192829_107398313300018812MarineAALIGVISATEVSQFKDLAPHSYIPSPYSLVQENEGSESESSESDDEDVQTQFDTIPVGYDGAHFYERKIPDRFSKDTDDIFMRSMITAYAHEEKSKVEEHDDGTKTGGEPTGRFWMNKDDATSAAREVLNTHKGLSGAALDQYIATFFDKAWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193053_105880413300018823MarineLIGVISAAQVSEFSDIAPHSYIESPVALVQQAAESESESSDSDDEDVQTQFDTIPVGYDGAHFYERKIPDRFSKDTDDIFMRSMITSYAHEEKSKVVEHDDGTKSGGEPTGKFWMNKEDALSAAKEVLNTHKGLSGGALDQYIATFFDKAWGHFDVNKSGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193053_105898513300018823MarineELAPHSYIESPNNLVQQAAESESESSDSEEEDIQTQFDTFPVAYSGTHFYERAIPERFSKDTDDIFMRSMIKTYAHEEKSKVVEHDDGTKSGGEPTGKFWMNKEDALSAAKEVLGTHKGLAGAALDQYIATFFDKAWGHFDVNKSGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192949_107954013300018831MarineKFVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEVQTQFDTIPVGYDGAHFYERQIPERFSKDTDDIFMRSMITAYAHEEKSKVEEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193302_106386513300018838MarineLGVISATKVSDFSTLAPHSYIENPNNLVQQAVESESESSDSEEEDVQTGVDSKFDTFPVAYDGAHFYERVIPDRFSKDTDDIFMRSMIKTYAHEEKSKVVDHDDGTKSGGEPTGRFWMNKEDALSAAKEVLGTHKGLAGGALDQYIATFFEKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193253_110144713300018846MarineMKFVVAALIGVISAGEVSEFKDLAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTARFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193253_110605113300018846MarineKMKFAVALLIGAVSATKVEEFSTIAPHSYIETPFNPNYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERVITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQYMSLKESG
Ga0192970_106810713300018848MarineKFVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFSRFLASDQWMSLKESG
Ga0193311_1003846913300018885MarineLFVVALLLGVISATKVSDFSSLAPHSYIENPNSLVQQAVESESESSDSEEEDVQTAADSKFDTFPVAYAGAHFYERVIPDRFSKDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKSGGEPTGRFWMNKEDALSAAKEVLGTHKGLAGGALDQYIATFFEKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193311_1003966813300018885MarineMKFAVALLIGVISATKVENFSELAPHSYIESPNNLVQQAAESESESSDSEEEDIQTQFDTFPVAYSGTHFYERALPERFSKDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKSGGEPTGRFWMNKEDALSAAKEVLGTHKGLAGGALDQYIATFFEKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193311_1003992013300018885MarineALLLGVISATKVSDFSTLAPHSYIENPNNLVQQAVESESESSDSEEEDVQTGVDSKFDTFPVAYDGAHFYERVIPDRFSKDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKSGGEPTGRFWMNKEDALSAAKEVLGTHKGLAGGALDQYIATFFEKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193090_110471313300018899MarineKFVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFSRFLASDQWMSLKESG
Ga0192989_1011830713300018926MarineKFVVAALIGVISAGEVSEFKDLAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTARFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192989_1012696213300018926MarineKFAVALLIGAVSATKVEEFSTIAPHSYIETPFNPNYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERVITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQYMSLKESG
Ga0193178_1004027913300018967MarineLLGVISAAQVSEFSDLAPHSYIESPYSLVQQAAESESESSESDDEDVQTQFDTIPVGYDGAHFYERKIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAREVLNTHKGLSGGALDQYIATFFDKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193254_1010949613300018976MarineMKFAVALLIGAVSATKVEEFSTIAPHSYIETPFNPNYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERVITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQYMSLKESG
Ga0193353_1025089513300018977MarineDSDSDDSSGSDEDIQTATDARLPPPKDTFPVGLDKSSFYERVITPNFSQDTDDLFMRSMITSYAHEEKSEVKEHDDGTKTGGEPTGRFWMNKEDAMSAAKEVLDTHKGMTGGSLDQYLATFFNKAWGHFDVNQSGWIEVIKMPQFMRFLASDQWMSLKESG
Ga0193540_1011729213300018979MarineGNYATDAANARPPYKLNYIQQADSDSSSDSSDSEDEEVQSQADVRFETFPVGLDKSTVYERVVTPRFSQDTDDIFMRSMIKTYAHEEASKVVEHDDGTKTGGEPTGNFWMSKDDAMTAAKEVLSTHKGLSGGALDSYLGTFFDKAWKHFDVNLTGWVEVIKMPQFMRFLASDQWMSLKES
Ga0193540_1015542213300018979MarineFSDLAPHSYIESPVSLVQQSAESESESSDSEDEDVQTQFDTFPVGYDGSHFYERVVPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLGTHKGLAGAALDQYIATFFDKSWGHFDVNKSGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193540_1018023613300018979MarineQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTPRFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSAAREVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192961_1014383813300018980MarineMGYKINKLKMKFVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEVQTQFDTIPVGYDGAHFYERQIPERFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKSGGEPTGKFWMNKEDALSAAKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192968_1010659013300018981MarineTWGKIIKLKMKFVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFSRFLASDQWMSLKESG
Ga0192947_1019622913300018982MarineSDYKDIAPHSYIEAPVSLVQEESESESSDDEEVQTQFDTIPVGYDGAHFYERQIPERFSKDTDDIFMRSMITAYAHEEKSKVEEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193030_1020665713300018989MarineFKDLAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTPRFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSAAREVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193569_1028779413300019017MarineKFVVAALIGVISAGEVSEFKDLAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTPRFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSAAREVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192982_1018863813300019021MarineHGDKIIKLKMKFVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFSRFLASDQWMSLKESGXASGSQKDVNRTLISANANSDNISHENFI
Ga0192951_1014203213300019022MarineMKLVIALFIGLVAADDTNTIWGLTSTVSERSNAGTQVDYAGYSADRANARGPYDHSFVQNQESESESSDSDDSGDEDIQTKFDTFPIGLDGSQFYERKVTERFSQDTDDIFMRSMIAQYAHEEKSEVVEHDNGTKSGGEPTGKFWMNQGDALLAAKEVLATHKGLTGTALEQYLTTFFAKSWGHFDVNQTGWIEVIKMPQFCRFLASDQYMSLKESG
Ga0192951_1020323713300019022MarineTWGKINKLKMKFVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEVQTQFDTIPVGYDGAHFYERQIPERFSKDTDDIFMRSMITAYAHEEKSKVEEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193545_1009058213300019025MarineMKFVVAALIGVISAAQVSEFSDLAPHSYIEAPVSLVQQAAESESESSESDDEEVQTQFDTIPVGYDGAHFYERQIPERFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAREVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192945_1012250813300019036MarineMKLVIALFIGLVAADDTNTIWGLTSTVSERSNAGTQVDYAGYSADRANARGPYDHSFVQNQESESESSDSDDSGDEDIQTKFDTFPIGLDGSQFYERKVTERFSQDTDDIFMRSMIAQYAHEEKSEVVEHDNGTKSGGEPTGKFWMNQGDALLAAKEVLATHKGLTGTALEQYLTTFFAKSWGHFDVNQTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0193336_1044533213300019045MarineMKFVVAALIGVISAAQVENYKDLAPHSYIDSPYSLLQEADKEGESESESDDEAVQTQFDTIPVGYDGAHFYERVIPERFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192981_1023608013300019048MarineTWGYKFNKLKMKFVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFSRFLASDQWMSLKESG
Ga0192966_1017908813300019050MarineMKFVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFSRFLASDQWMSLKESGXASGSQKDVNRTLISANANSDNISHENFI
Ga0192826_1022071813300019051MarineMKFVVAALIGVISATEVSQFKDLAPHSYIPSPYSLIQENEGSESESSESDDEDVQTQFDTIPVGYDGAHFYERKIPDRFSKDTDDIFMRSMITAYAHEEKSKVEEHDDGTKTGGEPTGRFWMNKDDATSAAREVLNTHKGLSGAALDQYIATFFDKAWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0188866_102231013300019095Freshwater LakeMKFAVAVLIGAVAATKIEEFSTIAPHSYIETPFNPNYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG
Ga0192972_107508913300019108MarineVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFSRFLASDQWMSLKESG
Ga0193104_103081413300019125MarineMKFVVAALICVISAGEVSEFKDLAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTPRFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSAAREVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0188870_1015389713300019149Freshwater LakeFVVAALIGVISAGEVSEFKDLAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTPRFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSAAREVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKM
Ga0194244_1006729713300019150MarinePHSYIPSPYSLIQENEGSESESSESDDEDVQTQFDTIPVGYDGAHFYERKIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMSKDDALSAAKEVLGTHKGLAGAALDQYIATFFDKTWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0192975_1021666813300019153MarineMKFVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFSRFLASDQWMSLKESG
Ga0206687_181890813300021169SeawaterMKFVVAALIGVISAGEVSEFKDLAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTPRFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSAAREVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0206692_187233613300021350SeawaterMKFVVAALIGVISAGEVSEFKDLAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTPRFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSAAKEVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0063135_105405213300021908MarineMKFAVALLIGAVSATKVEEFSTIAPHSYIEKPFNPNYIQQESESESSDSEDEALQTTADARFDTFPVAYDGTHFYERVITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLATHKGLGGAALDQYVATFFDKSWGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG
Ga0063133_108720213300021912MarineFAVALLIGAVSATKVEEFSTIAPHSYIEKPFNPNYIQQESESESSDSEDEALQTTADARFDTFPVAYDGTHFYERVITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDALSAAKEVLATHKGLGGAALDQYVATFFDKSWGHFDVNK
Ga0232113_102681713300023679SeawaterVSEFKDLAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTPRFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSAAKEVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0228684_104429513300023704SeawaterKFVVAALIGVISAGEVSEFKDLAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTPRFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSAAKEVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0209505_110993013300025690Pelagic MarinePPMRSSFMQTHKAAEQSESESDTDSSSSDDEDVQAHSDVRFDTIPVGFDKSNYYERQITPMFSKDTDDLFMRSMIATYAHEEKSPVVDQPDGSKTGGEPIGKFWMNKEDATSAAKEVLSTHKGLTGAALDQYLNTFFEKSWGHFDVNKSGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0247599_108951813300026470SeawaterIGVISAGEVSEFKDLAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTPRFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSAAREVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0247571_107571513300026495SeawaterMKSCALIGVISAGEVSEFKDLAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTPRFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSAAKEVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0247592_110483213300026500SeawaterVVAALIGVISAGEVSEFKDLAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTPRFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSAAREVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0247605_112925013300026503SeawaterMKFVVAALIGDISAGEVSEFKDLAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTPRFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSAAKEVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0247590_111841613300026513SeawaterFVVAALIGVISAGEVSEFKDLAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTPRFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFWMNKEDALSAAKEVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0247597_104374713300028334SeawaterAPHSYIPSPYSLVQENEGTESESSESDDEDVQTQFDTIPVGYDGAHFYERKVTPRFSQDTDDIFMRSMITAYAHEEKSKVEEHDDGTKSGGEPTGKFLMNKEDALSAAKEVLNTHKGLAGAALDQYIATFFDKSWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0307401_1054872913300030670MarineESESESSDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFSRFLASDQWMSLKESG
Ga0307398_1049369213300030699MarineFVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFSRFLASDQWMSLKESG
Ga0073986_1197167513300031038MarineGVISAAQVSEFSDLAPHSYIESPNTLVQQAAESESESSESDDEEIQTQFDTIPVGYDGAHFYERQIPERFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKTGGEPTGKFWMNKEDALSAAREVLNTHKGLSGGALDQYIATFFDKAWGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0073989_1333358513300031062MarineKFVVAALIGVISATEVSQFKDLAPHSYIPSPYSLVQENEGSESESSESDDEDVQTQFDTIPVGYDGAHFYERKIPDRFSKDTDDIFMRSMITAYAHEEKSKVEEHDDGTKTGGEPTGRFWMNKDDATSAAREVLNTHKGLSGAALDQYIATFFDKAWGHFDVNRTGWIEVIKMPQFCRFLASDQWMSL
Ga0307393_113447613300031674MarineVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFLRSMITAYAHEEKSKVVEHDDGSKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQFSRFLASDQWMSLK
Ga0307395_1035754613300031742MarineKFVVAALIGVISAAQVSDYKDIAPHSYIEAPVSLVQEESESESSDDEEIQTQFDTIPVGYDGAHFYERQIPDRFSKDTDDIFMRSMITAYAHEEKSKVVEHDDGTKSGGEPTGKFWMNKEDALSASKEVLNTHKGLAGAALDQYIATFFDKAWGHFDVNKGGWIEVIKMPQCSRFLASDQWMSLKESG
Ga0314680_1092756713300032521SeawaterQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG
Ga0314682_1060822713300032540SeawaterAVAVLIGAVAATKIEEFSTIAPHSYIETPFNPNYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG
Ga0314683_1067985313300032617SeawaterFAVAVLIGAVAATKIEEFSTIAPHSYIETPFNPDYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG
Ga0314687_1048929313300032707SeawaterKMKFAVAVLIGAVAATKIEEFSTIAPHSYIETPFNPDYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0314669_1051888813300032708SeawaterKFAVAVLIGAVAATKIEEFSTIAPHSYIETPFNPNYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG
Ga0314681_1056898313300032711SeawaterKFAVAVLIGAVAATKIEEFSTIAPHSYIETPFNPNYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQWMSLKESG
Ga0314704_1064204213300032745SeawaterKFAVAVLIGAVAATKIEEFSTIAPHSYIETPFNPNYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQFCRFLASDQWMS
Ga0314713_1045248113300032748SeawaterKFAVAVLIGAVAATKIEEFSTIAPHSYIETPFNPNYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVTKMPQF
Ga0314708_1041033213300032750SeawaterAVAVLIGAVAATKIEEFSTIAPHSYIETPFNPNYIQQESESESSDSDDEALQTTADARFDTFPVAYDGTHFYERQITPMFSQDTDDIFMRSMIKTYAHEEKSKVEEHDDGTKTGGEPTGKFWMNKEDTLSAAKEVLATHKGLGGAALDQYIATFFDKSFGHFDVNKTGWIEVIKMPQFCRFLASDQWMSLKESG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.