Basic Information | |
---|---|
Family ID | F102845 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 101 |
Average Sequence Length | 48 residues |
Representative Sequence | MPAAKKPVAKGSVAKTFDVNKLMPKMTPQDKAMLKILKKKYGNDVYKK |
Number of Associated Samples | 72 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 73.27 % |
% of genes near scaffold ends (potentially truncated) | 12.87 % |
% of genes from short scaffolds (< 2000 bps) | 82.18 % |
Associated GOLD sequencing projects | 66 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (29.703 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (29.703 % of family members) |
Environment Ontology (ENVO) | Unclassified (50.495 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (46.535 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.95% β-sheet: 0.00% Coil/Unstructured: 71.05% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF01807 | zf-CHC2 | 0.99 |
PF13252 | DUF4043 | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.18 % |
Unclassified | root | N/A | 17.82 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_109117008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 600 | Open in IMG/M |
3300002408|B570J29032_109843570 | All Organisms → Viruses → Predicted Viral | 1601 | Open in IMG/M |
3300002408|B570J29032_109925154 | All Organisms → Viruses → Predicted Viral | 2823 | Open in IMG/M |
3300002447|JGI24768J34885_10026450 | All Organisms → Viruses → Predicted Viral | 1933 | Open in IMG/M |
3300002835|B570J40625_100811175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 821 | Open in IMG/M |
3300002835|B570J40625_101750513 | Not Available | 505 | Open in IMG/M |
3300004112|Ga0065166_10390181 | Not Available | 580 | Open in IMG/M |
3300004481|Ga0069718_16272470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1108 | Open in IMG/M |
3300005527|Ga0068876_10422373 | Not Available | 741 | Open in IMG/M |
3300006802|Ga0070749_10398611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 759 | Open in IMG/M |
3300008055|Ga0108970_10788982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2897 | Open in IMG/M |
3300008107|Ga0114340_1056735 | All Organisms → Viruses → Predicted Viral | 2551 | Open in IMG/M |
3300008107|Ga0114340_1097675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1180 | Open in IMG/M |
3300008110|Ga0114343_1058476 | All Organisms → Viruses → Predicted Viral | 1458 | Open in IMG/M |
3300008116|Ga0114350_1117585 | Not Available | 806 | Open in IMG/M |
3300009009|Ga0105105_10403711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 763 | Open in IMG/M |
3300009026|Ga0102829_1297062 | Not Available | 537 | Open in IMG/M |
3300009068|Ga0114973_10099707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1652 | Open in IMG/M |
3300009075|Ga0105090_10207730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1212 | Open in IMG/M |
3300009081|Ga0105098_10185468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 953 | Open in IMG/M |
3300009082|Ga0105099_10529833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
3300009082|Ga0105099_10956442 | Not Available | 543 | Open in IMG/M |
3300009085|Ga0105103_10349411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 813 | Open in IMG/M |
3300009085|Ga0105103_10631216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 611 | Open in IMG/M |
3300009151|Ga0114962_10020392 | All Organisms → Viruses → Predicted Viral | 4693 | Open in IMG/M |
3300009163|Ga0114970_10480708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 680 | Open in IMG/M |
3300009165|Ga0105102_10402766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
3300009165|Ga0105102_10424941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 710 | Open in IMG/M |
3300009165|Ga0105102_10579858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 618 | Open in IMG/M |
3300009165|Ga0105102_10820024 | Not Available | 531 | Open in IMG/M |
3300009169|Ga0105097_10088382 | All Organisms → Viruses → Predicted Viral | 1689 | Open in IMG/M |
3300009169|Ga0105097_10168052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1207 | Open in IMG/M |
3300009169|Ga0105097_10180525 | All Organisms → Viruses → Predicted Viral | 1162 | Open in IMG/M |
3300009169|Ga0105097_10744244 | Not Available | 556 | Open in IMG/M |
3300009170|Ga0105096_10422724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 688 | Open in IMG/M |
3300009183|Ga0114974_10324984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 898 | Open in IMG/M |
3300012706|Ga0157627_1098006 | All Organisms → Viruses → Predicted Viral | 1357 | Open in IMG/M |
3300012708|Ga0157595_1013220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 592 | Open in IMG/M |
3300012711|Ga0157607_1004291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 877 | Open in IMG/M |
3300012714|Ga0157601_1218079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 699 | Open in IMG/M |
3300012716|Ga0157605_1009134 | Not Available | 573 | Open in IMG/M |
3300012721|Ga0157612_1019954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 554 | Open in IMG/M |
3300013006|Ga0164294_10072254 | All Organisms → Viruses → Predicted Viral | 2611 | Open in IMG/M |
3300013372|Ga0177922_11168310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 650 | Open in IMG/M |
3300017723|Ga0181362_1049834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 872 | Open in IMG/M |
3300019122|Ga0188839_1014893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
3300019784|Ga0181359_1038905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1842 | Open in IMG/M |
3300019784|Ga0181359_1145870 | Not Available | 817 | Open in IMG/M |
3300020048|Ga0207193_1291077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1182 | Open in IMG/M |
3300020048|Ga0207193_1578238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
3300020048|Ga0207193_1826485 | Not Available | 565 | Open in IMG/M |
3300020498|Ga0208050_1011985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 956 | Open in IMG/M |
3300020505|Ga0208088_1010508 | Not Available | 1291 | Open in IMG/M |
3300020506|Ga0208091_1005264 | All Organisms → Viruses → Predicted Viral | 1750 | Open in IMG/M |
3300020530|Ga0208235_1004696 | All Organisms → Viruses → Predicted Viral | 1915 | Open in IMG/M |
3300020530|Ga0208235_1009709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1244 | Open in IMG/M |
3300021963|Ga0222712_10019641 | Not Available | 5669 | Open in IMG/M |
3300021963|Ga0222712_10051364 | All Organisms → Viruses → Predicted Viral | 3076 | Open in IMG/M |
3300022179|Ga0181353_1097287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 727 | Open in IMG/M |
3300023184|Ga0214919_10268814 | All Organisms → Viruses → Predicted Viral | 1205 | Open in IMG/M |
3300023184|Ga0214919_10453240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 809 | Open in IMG/M |
3300025091|Ga0209616_1003138 | All Organisms → Viruses → Predicted Viral | 2489 | Open in IMG/M |
3300027679|Ga0209769_1092436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 984 | Open in IMG/M |
3300027736|Ga0209190_1135667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1084 | Open in IMG/M |
3300027743|Ga0209593_10127164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 925 | Open in IMG/M |
3300027749|Ga0209084_1191563 | Not Available | 828 | Open in IMG/M |
3300027754|Ga0209596_1401624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 514 | Open in IMG/M |
3300027759|Ga0209296_1048394 | All Organisms → Viruses → Predicted Viral | 2233 | Open in IMG/M |
3300027760|Ga0209598_10050345 | All Organisms → Viruses → Predicted Viral | 2150 | Open in IMG/M |
3300027792|Ga0209287_10143254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 905 | Open in IMG/M |
3300027792|Ga0209287_10406444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300027805|Ga0209229_10082796 | All Organisms → Viruses → Predicted Viral | 1442 | Open in IMG/M |
3300027805|Ga0209229_10174420 | Not Available | 965 | Open in IMG/M |
3300027836|Ga0209230_10007523 | All Organisms → Viruses → Predicted Viral | 4782 | Open in IMG/M |
3300027956|Ga0209820_1170305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 604 | Open in IMG/M |
3300028025|Ga0247723_1008900 | All Organisms → Viruses → Predicted Viral | 4078 | Open in IMG/M |
3300028025|Ga0247723_1028043 | All Organisms → Viruses → Predicted Viral | 1808 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1272106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
(restricted) 3300028571|Ga0247844_1130214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1070 | Open in IMG/M |
3300031857|Ga0315909_10361146 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300031951|Ga0315904_10272814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1603 | Open in IMG/M |
3300031951|Ga0315904_11455929 | Not Available | 507 | Open in IMG/M |
3300033980|Ga0334981_0459079 | Not Available | 537 | Open in IMG/M |
3300033981|Ga0334982_0046635 | All Organisms → Viruses → Predicted Viral | 2411 | Open in IMG/M |
3300033981|Ga0334982_0438304 | Not Available | 587 | Open in IMG/M |
3300033993|Ga0334994_0041067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 2939 | Open in IMG/M |
3300033996|Ga0334979_0068062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 2268 | Open in IMG/M |
3300033996|Ga0334979_0088056 | All Organisms → Viruses → Predicted Viral | 1951 | Open in IMG/M |
3300034012|Ga0334986_0237707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 997 | Open in IMG/M |
3300034012|Ga0334986_0283583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 885 | Open in IMG/M |
3300034050|Ga0335023_0224364 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
3300034061|Ga0334987_0657118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 608 | Open in IMG/M |
3300034062|Ga0334995_0154069 | All Organisms → Viruses → Predicted Viral | 1655 | Open in IMG/M |
3300034101|Ga0335027_0202179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1410 | Open in IMG/M |
3300034106|Ga0335036_0099295 | All Organisms → Viruses → Predicted Viral | 2139 | Open in IMG/M |
3300034106|Ga0335036_0143337 | All Organisms → Viruses → Predicted Viral | 1707 | Open in IMG/M |
3300034106|Ga0335036_0261247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1167 | Open in IMG/M |
3300034106|Ga0335036_0819164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 537 | Open in IMG/M |
3300034121|Ga0335058_0000345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36817 | Open in IMG/M |
3300034121|Ga0335058_0317885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 902 | Open in IMG/M |
3300034283|Ga0335007_0088467 | All Organisms → Viruses → Predicted Viral | 2316 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 29.70% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 19.80% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.91% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.92% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.94% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.96% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 3.96% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.96% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 2.97% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.97% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.98% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.98% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.99% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.99% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.99% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.99% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.99% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012708 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012711 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012721 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020505 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1091170083 | 3300002408 | Freshwater | MPNIKKAVAKGSVAKTFDTSKLIPKMTPQDKAMLKILKKKYGNDVYKK* |
B570J29032_1098435704 | 3300002408 | Freshwater | MAAAKKARPKTSLEKTFDISKLVPKMTPQDKASLALLKKKYGKDVYKGYGK* |
B570J29032_1099251546 | 3300002408 | Freshwater | MATAKKAVAKGSVAKTFDVNKLKPKMTPQDRAMLKILQNKYGKDVYKG* |
JGI24768J34885_100264504 | 3300002447 | Freshwater And Sediment | MAVAKKAVAKKGSVAKTFDVKKLMPKMTKEDAAMKKLLEKKYGKIYG* |
B570J40625_1008111752 | 3300002835 | Freshwater | MPNMKKPVAKGSVAKTFDPKKLKPKMTAQDAAMLKILKKKYGADVYKG* |
B570J40625_1017505131 | 3300002835 | Freshwater | MPGAKKPAPKKGSVAKTFDTSKLKTKMTPQDAAMKKLLEKKYGKIYG* |
Ga0065166_103901811 | 3300004112 | Freshwater Lake | KKAAAKGSVAKTFDPNKLKPKMTAQDKAMLKILQNKYGKDVYKG* |
Ga0069718_162724703 | 3300004481 | Sediment | MAIAKKPVAKGSVAKTFDVKKLMPKMTPQDAAMLKILKKKYGNDVYKK* |
Ga0068876_104223732 | 3300005527 | Freshwater Lake | MATVKKAVAKGSVAKTFDVNKLKPKMTPQDKAMLNILKKKYGKDVYKG* |
Ga0070749_103986112 | 3300006802 | Aqueous | MAAAKKAPAKGSVAKTFNVNKLKPKMTAQDAAMLKILKKKYGADVYKG* |
Ga0108970_107889821 | 3300008055 | Estuary | MAAAKKAPAKGSVAKTFDAKKLMPKMTPQDAAMLKLLKKKYGADVYKG* |
Ga0114340_10567357 | 3300008107 | Freshwater, Plankton | MAAAKKARPKTSLEKTFDINKLMPKMTPQDKASLALLKKKYGKDVYKGYGK* |
Ga0114340_10976753 | 3300008107 | Freshwater, Plankton | MPNMKKPVTKGSVAKTIDAKKLIPKMTPQDKAMLNILKKKYGANVYKG* |
Ga0114343_10584763 | 3300008110 | Freshwater, Plankton | MAAAKKPAPKGSVAKTFDVSKLMPKMTPQDKASLALLKKKYGKDVYKGYGK* |
Ga0114350_11175854 | 3300008116 | Freshwater, Plankton | MPAAKKPVVKGSVAKTIDAKKLIPKMTPQDKAMLNILKKKYGANVYKG* |
Ga0105105_104037112 | 3300009009 | Freshwater Sediment | MPNAKKPTAKGSVAKTFDVKKLMPKMTPQDKAMLKLLKKKYGADVYKG* |
Ga0102829_12970623 | 3300009026 | Estuarine | EVCKAWIVWWTLMATKKKAASKGSVAKTFDINKLLPKMTKQDAQSLAMLKKKYGKDVYKSYGK* |
Ga0114973_100997072 | 3300009068 | Freshwater Lake | MAAAKKITAKGSVAKTFDTSKLVPKMTPQDKAMLNILKKKYGKDVYKG* |
Ga0105090_102077302 | 3300009075 | Freshwater Sediment | MPGAMKKAVAKGSVAKTFDVKKLVPKMTPQDKAMLKILKKKYGADVYKK* |
Ga0105098_101854682 | 3300009081 | Freshwater Sediment | MPNPNMKKPVAKGSVAKTFDVKKLMPKMTPQDKAMLKILKKKYGNDVYKK* |
Ga0105099_105298331 | 3300009082 | Freshwater Sediment | MAVAKKAAAKGSVAKTFDVNKLMPKMTPQDRASLNMLKKKYGKDVYKSYGK* |
Ga0105099_109564422 | 3300009082 | Freshwater Sediment | MPNAKKPTAKGSVAKTFDVKKLMTKMTPQDKAMLKLLKKKYGADVYKG* |
Ga0105103_103494111 | 3300009085 | Freshwater Sediment | MKKPVAKGSVAKTFDVKKLIPKMTPQDKAMLKILQKKYGKDVYKK* |
Ga0105103_106312162 | 3300009085 | Freshwater Sediment | MPGAMKKAVAKGSVAKTFDPKKLKPKMTAQDAAMLKILKKKYGADVYKK* |
Ga0114962_100203927 | 3300009151 | Freshwater Lake | MATIKKPVVKGSVAKTIDPKKLMPKMTPQDKAMLKILRNKYGKDVYKD* |
Ga0114970_104807082 | 3300009163 | Freshwater Lake | MAAPKKPTPKGSIAKLVDTKKLMPKMTPQDKAMLKILKNKYGKDVYNG* |
Ga0105102_104027661 | 3300009165 | Freshwater Sediment | MAVAKKAAAKGSVAKTFDINKLMPKMTPQDRASLNMLKKKYGKDVYKSYG |
Ga0105102_104249413 | 3300009165 | Freshwater Sediment | MPNMKKPVAKGSVAKTFDVKKLIPKMTPQDKAMLKILQKKYGKDVYKK* |
Ga0105102_105798582 | 3300009165 | Freshwater Sediment | MPGAMKKPVAKGSVAKTIDANKLKPKMTPQDKAMLNILKKKYGPNVYKG* |
Ga0105102_108200241 | 3300009165 | Freshwater Sediment | MPGAMKKPVAKGSVAKTFDVKKLMPKMTPQDKAMLKLLKKKYGADVYKG* |
Ga0105097_100883821 | 3300009169 | Freshwater Sediment | MAVAKKAAAKGSVAKTIDINKLIPKMTKQDRDSLAMLKKKYGASVYKSYGK* |
Ga0105097_101680521 | 3300009169 | Freshwater Sediment | MPNAKKPTTKGSVAKTFDVKKLMPKMTPQDAAMLKILKKKYGADVYKG* |
Ga0105097_101805252 | 3300009169 | Freshwater Sediment | KGSVAKTFDVKKLIPKMTPQDKAMLKILQKKYGADVYKK* |
Ga0105097_107442442 | 3300009169 | Freshwater Sediment | MATAKKAVAKGSVAKTFDVKKLMPKMTPQDKAMLKILKKKYGENVYKG* |
Ga0105096_104227241 | 3300009170 | Freshwater Sediment | MPGAMKKPVAKGSVAKTFDPKKLKPKMTAQDAAMLKILKKKYGADVYKG* |
Ga0114974_103249842 | 3300009183 | Freshwater Lake | MAAAKKNEPKGSVAKTFDTSKLVPKMTPQDKAMLNILKKKYGKDVYKG* |
Ga0157627_10980062 | 3300012706 | Freshwater | MPGAMKKPAAKGSVAKTFDANKLKPKMTAQDAAMLKILKKKYGTDVYKG* |
Ga0157595_10132202 | 3300012708 | Freshwater | MPNPNMKKPVAKGSVAKTFDPKKLKPKMTAQDAAMLKILKKKYGTDVYKG* |
Ga0157607_10042912 | 3300012711 | Freshwater | PVAKVSVAKTFDHKKLKPKMTAQDAAMLKILKKKYGTDVYKG* |
Ga0157601_12180791 | 3300012714 | Freshwater | DKMPGAMKKPAAKGSVAKTFDANKLKPKMTAQDAAMLKILKKKYGTDVYKG* |
Ga0157605_10091341 | 3300012716 | Freshwater | MPNPNMKKPVAKGSVAKTFDPKKLKPKMTAQDAAMLKILKKKYGTDVYK |
Ga0157612_10199542 | 3300012721 | Freshwater | PNPNMKKPVAKGSVAKTFDPKKLKPKMTAQDAAMLKILKKKYGTDVYKG* |
Ga0164294_100722542 | 3300013006 | Freshwater | MPAAKKVVPKGSVAKTFDVKKLMPKMTPQDAAMLKILQKKYGKDVYKG* |
Ga0177922_111683102 | 3300013372 | Freshwater | MPGAMKKPVVKGSVAKTFDPKKLKPKMTAQDAAMLKILKKKYGADVYKG* |
Ga0181362_10498342 | 3300017723 | Freshwater Lake | MAQIKKPVVKGSVAKTFDTSKLMPKMTPQDAAMLKILKKKYGNDVYKK |
Ga0188839_10148934 | 3300019122 | Freshwater Lake | MAAAKKAKKGSVAKTFDITKITGKLTKQDKQSLAMLKRKYGSEPYRSYNK |
Ga0181359_10389052 | 3300019784 | Freshwater Lake | MPAAKKPVVKGSVAKTFDTSKLIPKMTPQDKAMLKILKKKYGNDVYKG |
Ga0181359_11458702 | 3300019784 | Freshwater Lake | MAQIKKPVVKGSVAKTFDTSKLMPKMTPQDKAMLKILKKKYGNDVYKK |
Ga0207193_12910772 | 3300020048 | Freshwater Lake Sediment | MPNMKKPVAKGSVAKTFDPKKLIPKMTPQDKAMLKILQKKYGADVYKK |
Ga0207193_15782382 | 3300020048 | Freshwater Lake Sediment | MPGAMKKPVAKGSVAKTFDPKKLVPKMTAQDAAMLKILKKKYGADVYKK |
Ga0207193_18264851 | 3300020048 | Freshwater Lake Sediment | MPGAMKKPVAKGSVAKTIDANKLKPKMTPQDKAMLNILKKKYGPNVYKG |
Ga0208050_10119852 | 3300020498 | Freshwater | MPGAKKPAAKGSVAKTFDASKLVPKMTAQDAAMLKILKKKYGADVYKK |
Ga0208088_10105084 | 3300020505 | Freshwater | MAAAKKARPKTSLEKTFDISKLVPKMTPQDKASLALLKKKYGKDVYKGYGK |
Ga0208091_10052642 | 3300020506 | Freshwater | MPNMKKPVAKGSVAKTFDPKKLKPKMTAQDAAMLKILKKKYGTDVYKG |
Ga0208235_10046962 | 3300020530 | Freshwater | MPNPNMKKPVAKGSVAKTFDPKKLKPKMTAQDAAMLKILKKKYGTDVYKG |
Ga0208235_10097092 | 3300020530 | Freshwater | MPNMKKPVAKGSVAKTFDPKKLKPKMTAQDAAMLKILKKKYGADVYKG |
Ga0222712_100196415 | 3300021963 | Estuarine Water | MAVAKKAAAKGSVAKTFDINKLIPKMTKQDAQSLAMLKKKYGKDVYKSYGK |
Ga0222712_100513644 | 3300021963 | Estuarine Water | MATAKKTPAKGSVAKTFDVKKLMPKMTAQDAAMLKILKKKYGNDVYKG |
Ga0181353_10972872 | 3300022179 | Freshwater Lake | MPNPNMKKPVAKGSVAKTFDPKKLKPKMTAQDAAMLKILKKKYGADVYKG |
Ga0214919_102688142 | 3300023184 | Freshwater | MAAKKKPAPKGSVAKTFDVNKLMPKMTPQDKASLELLKRQYGASVYRGYGK |
Ga0214919_104532402 | 3300023184 | Freshwater | MAAKKAPAKGSVAKTFDLNKLMPKMTPQDKAMLKILKDKYGKDVYKG |
Ga0209616_10031385 | 3300025091 | Freshwater | MAVAKKAVAKGSVAKTFDVKKLMPKMTPQDKAMLKILKKKYGENVYKG |
Ga0209769_10924361 | 3300027679 | Freshwater Lake | MPAAKKPVVKGSVAKTFDTSKLIPKMTPQDKAMLKILKKKYGNDVYK |
Ga0209190_11356672 | 3300027736 | Freshwater Lake | MAAPKKPTPKGSIAKLVDTKKLMPKMTPQDKAMLKILKNKYGKDVYNG |
Ga0209593_101271641 | 3300027743 | Freshwater Sediment | MPNPNMKKPVAKGSVAKTFDVKKLMPKMTPQDKAMLKILKKKYGNDVYKK |
Ga0209084_11915633 | 3300027749 | Freshwater Lake | MATIKKPVVKGSVAKTIDPKKLMPKMTPQDKAMLKILRNKYGKDVYKD |
Ga0209596_14016241 | 3300027754 | Freshwater Lake | PKKPTPKGSIAKLVDTKKLMPKMTPQDKAMLKILKNKYGKDVYNG |
Ga0209296_10483942 | 3300027759 | Freshwater Lake | MAAAKKNEPKGSVAKTFDTSKLVPKMTPQDKAMLNILKKKYGKDVYKG |
Ga0209598_100503452 | 3300027760 | Freshwater Lake | MAAAKKITAKGSVAKTFDTSKLVPKMTPQDKAMLNILKKKYGKDVYKG |
Ga0209287_101432542 | 3300027792 | Freshwater Sediment | MPNAKKPTAKGSVAKTFDVKKLMPKMTPQDKAMLKLLKKKYGADVYKG |
Ga0209287_104064441 | 3300027792 | Freshwater Sediment | MAVAKKAAAKGSVAKTFDVNKLMPKMTPQDRASLNMLKKKYGKDVYKSYG |
Ga0209229_100827967 | 3300027805 | Freshwater And Sediment | MATAKKVVAKGSVAKTFDVNKLKPKMTPQDKAMLKILQNKYGKDVYKG |
Ga0209229_101744205 | 3300027805 | Freshwater And Sediment | MATAKKVVAKGSVAKTFDVNKLKPKMTPQDKAMLKILQNKY |
Ga0209230_100075233 | 3300027836 | Freshwater And Sediment | MAVAKKAVAKKGSVAKTFDVKKLMPKMTKEDAAMKKLLEKKYGKIYG |
Ga0209820_11703051 | 3300027956 | Freshwater Sediment | MPGAMKKAVAKGSVAKTFDAKKLMPKMTPQDKAMLKILKKKYGNDVYKK |
Ga0247723_10089005 | 3300028025 | Deep Subsurface Sediment | MAVAKKAAAKGSIAKTFNTSKLIPKMTPQDKAMLNILKKKYGKDVYKG |
Ga0247723_10280432 | 3300028025 | Deep Subsurface Sediment | MATVKKAVAKGSVAKTFDVNKLKPKMTPQDKAMLKILQNKYGKDVYKG |
(restricted) Ga0247843_12721061 | 3300028569 | Freshwater | MAVAKKAVAKGSVAKTFDVNKLMPKMTPQDRASLAMLKKKYGKD |
(restricted) Ga0247844_11302143 | 3300028571 | Freshwater | MPAAKKPAAKGSVAKTFDTSKLIPKMTPQDAAMLKILKKKYGNDVYKK |
Ga0315909_103611461 | 3300031857 | Freshwater | MPNMKKPVTKGSVAKTIDAKKLIPKMTPQDKAMLNILKKKYGANVYKG |
Ga0315904_102728144 | 3300031951 | Freshwater | MPAAKKPVVKGSVAKTIDAKKLIPKMTPQDKAMLNILKKKYGANVYKG |
Ga0315904_114559292 | 3300031951 | Freshwater | MAAAKKARPKTSLEKTFDINKLMPKMTPQDKASLALLKKKYGKDVYKGYGK |
Ga0334981_0459079_251_406 | 3300033980 | Freshwater | MATAKKAVAKGSVAKTFDINKLMPKMTKQDAQSLAMLMKKYGKDVYKSYGK |
Ga0334982_0046635_1309_1455 | 3300033981 | Freshwater | MPNIKKAVAKGSVAKTFDTSKLIPKMTPQDKAMLKILKKKYGNDVYKK |
Ga0334982_0438304_359_505 | 3300033981 | Freshwater | MPGTKKPAVKGSVAKTIDANKLKPKMTPQDKAMLNILKKKYGPNVYKG |
Ga0334994_0041067_129_278 | 3300033993 | Freshwater | MPGAMKKPVAKGSVAKTFDVKKLVPKMTPQDAAMLKILKKKYGNDVYKK |
Ga0334979_0068062_149_298 | 3300033996 | Freshwater | MPGAMKKPAAKGSVAKTFDANKLKPKMTAQDAAMLKILKKKYGNDVYKG |
Ga0334979_0088056_445_591 | 3300033996 | Freshwater | MPAAKKPVAKGSVAKTFDVNKLMPKMTPQDKAMLKILKKKYGNDVYKK |
Ga0334986_0237707_230_373 | 3300034012 | Freshwater | MPGAKKTAPKKGSVAKTFDTSKLKTKMTPQDAAMKKLLEKKYGKIYG |
Ga0334986_0283583_625_771 | 3300034012 | Freshwater | MPNMKKPVAKGSVAKTFDPKKLVPKMTAQDAAMLKLLKKKYGADVYKG |
Ga0335023_0224364_671_820 | 3300034050 | Freshwater | MPGAMKKPVVKGSVAKTFDVKKLMPKMTPQDKAMLKILKKKYGADVYKR |
Ga0334987_0657118_350_499 | 3300034061 | Freshwater | MPGAMKKPVVKGSVAKTIDANKLKPKMTPQDKAMLNILKKKYGPNVYKG |
Ga0334995_0154069_1065_1211 | 3300034062 | Freshwater | MPAAKKPAAKGSVAKTFDTSKLIPKMTPQDAAMLKLLKKKYGADVYKK |
Ga0335027_0202179_300_437 | 3300034101 | Freshwater | MKKPVAKGSVAKTFDVKKLIPKMTPQDKAMLKILQKKYGKDVYKK |
Ga0335036_0099295_923_1072 | 3300034106 | Freshwater | MPGAAKKAPAKGSVAKTIDANKLKPKMTPQDKAMLNILKKKYGANVYKG |
Ga0335036_0143337_507_662 | 3300034106 | Freshwater | MAVAKKAAAKGSVAKTFDVNKLMPKMTPQDRASLNMLKKKYGKDVYKSYGK |
Ga0335036_0261247_654_803 | 3300034106 | Freshwater | MPGAMKKAVAKGSVAKTFDVKKLVPKMTPQDKAMLKILKKKYGADVYKK |
Ga0335036_0819164_10_147 | 3300034106 | Freshwater | MKKPVAKGSVAKTFDVKKLMPKMTPQDKAMLKILKKKYGNDVYKK |
Ga0335058_0000345_11140_11295 | 3300034121 | Freshwater | MATAKKAVAKGSVAKTFDINKLIPQMTKQDAQSLAMLKKKYGAKVYKSYDK |
Ga0335058_0317885_280_426 | 3300034121 | Freshwater | MPNMKKPAAKGSVAKTFDVKKLMPKMTAQDAAMLKILKKKYGADVYKK |
Ga0335007_0088467_228_374 | 3300034283 | Freshwater | MATAKKAVAKGSVAKTFDVKKLTPKMTPQDKAMLKILKKKYGENVYKG |
⦗Top⦘ |