NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102794

Metagenome / Metatranscriptome Family F102794

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102794
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 40 residues
Representative Sequence NRSDVMTVAVVARTDPQEQESVVTLSLPPHLAELDDFPVASP
Number of Associated Samples 93
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 95.05 %
% of genes from short scaffolds (< 2000 bps) 90.10 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (59.406 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(30.693 % of family members)
Environment Ontology (ENVO) Unclassified
(27.723 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.535 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.43%    β-sheet: 0.00%    Coil/Unstructured: 88.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF02347GDC-P 7.92
PF02659Mntp 1.98
PF08811DUF1800 0.99
PF07883Cupin_2 0.99
PF13191AAA_16 0.99
PF00478IMPDH 0.99
PF07690MFS_1 0.99
PF13305TetR_C_33 0.99
PF12681Glyoxalase_2 0.99
PF10282Lactonase 0.99
PF02738MoCoBD_1 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG0403Glycine cleavage system protein P (pyridoxal-binding), N-terminal domainAmino acid transport and metabolism [E] 7.92
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 7.92
COG1971Putative Mn2+ efflux pump MntPInorganic ion transport and metabolism [P] 1.98
COG5267Uncharacterized conserved protein, DUF1800 familyFunction unknown [S] 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A59.41 %
All OrganismsrootAll Organisms40.59 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003505|JGIcombinedJ51221_10283000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia674Open in IMG/M
3300005337|Ga0070682_101991770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300005439|Ga0070711_101403572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300005542|Ga0070732_10015849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4205Open in IMG/M
3300005558|Ga0066698_10741032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia643Open in IMG/M
3300005561|Ga0066699_10569925All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300005615|Ga0070702_100194079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1339Open in IMG/M
3300005921|Ga0070766_10033395All Organisms → cellular organisms → Bacteria2816Open in IMG/M
3300006058|Ga0075432_10601228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia503Open in IMG/M
3300006806|Ga0079220_10800448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia713Open in IMG/M
3300007076|Ga0075435_100721692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia866Open in IMG/M
3300009521|Ga0116222_1519702Not Available522Open in IMG/M
3300009522|Ga0116218_1547983Not Available515Open in IMG/M
3300009523|Ga0116221_1529332Not Available517Open in IMG/M
3300010047|Ga0126382_12037679Not Available547Open in IMG/M
3300010048|Ga0126373_12249703Not Available606Open in IMG/M
3300010154|Ga0127503_10246999Not Available846Open in IMG/M
3300010341|Ga0074045_10272704Not Available1114Open in IMG/M
3300010379|Ga0136449_101864946Not Available896Open in IMG/M
3300010876|Ga0126361_10182704Not Available552Open in IMG/M
3300012208|Ga0137376_11177518Not Available655Open in IMG/M
3300013307|Ga0157372_11717660Not Available722Open in IMG/M
3300014501|Ga0182024_12858031Not Available512Open in IMG/M
3300015245|Ga0137409_10869535Not Available737Open in IMG/M
3300015374|Ga0132255_106000752Not Available514Open in IMG/M
3300016294|Ga0182041_11938372Not Available548Open in IMG/M
3300017821|Ga0187812_1237238All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300017926|Ga0187807_1113125Not Available857Open in IMG/M
3300017926|Ga0187807_1308748Not Available526Open in IMG/M
3300017932|Ga0187814_10153463Not Available859Open in IMG/M
3300017937|Ga0187809_10053117All Organisms → cellular organisms → Bacteria1310Open in IMG/M
3300017943|Ga0187819_10521581Not Available677Open in IMG/M
3300017948|Ga0187847_10358283Not Available799Open in IMG/M
3300018060|Ga0187765_11039847Not Available564Open in IMG/M
3300018062|Ga0187784_10404029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1104Open in IMG/M
3300018062|Ga0187784_11133386All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300018090|Ga0187770_11266990Not Available597Open in IMG/M
3300020581|Ga0210399_10338340All Organisms → cellular organisms → Bacteria → Proteobacteria1256Open in IMG/M
3300020582|Ga0210395_10147202All Organisms → cellular organisms → Bacteria1756Open in IMG/M
3300021171|Ga0210405_10073749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2688Open in IMG/M
3300021178|Ga0210408_11039069Not Available632Open in IMG/M
3300021180|Ga0210396_11527437Not Available548Open in IMG/M
3300021377|Ga0213874_10229096Not Available678Open in IMG/M
3300021404|Ga0210389_10034166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3907Open in IMG/M
3300021405|Ga0210387_10073495All Organisms → cellular organisms → Bacteria2802Open in IMG/M
3300021407|Ga0210383_11786864Not Available501Open in IMG/M
3300021433|Ga0210391_11441039Not Available529Open in IMG/M
3300021444|Ga0213878_10322900Not Available665Open in IMG/M
3300021478|Ga0210402_11726925Not Available552Open in IMG/M
3300022713|Ga0242677_1010070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. YIM 1210381018Open in IMG/M
3300025509|Ga0208848_1047930Not Available913Open in IMG/M
3300025907|Ga0207645_10235504All Organisms → cellular organisms → Bacteria → Acidobacteria1209Open in IMG/M
3300025916|Ga0207663_11085909All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium643Open in IMG/M
3300025929|Ga0207664_11010407Not Available745Open in IMG/M
3300026078|Ga0207702_11958522Not Available577Open in IMG/M
3300027641|Ga0208827_1017465All Organisms → cellular organisms → Bacteria2677Open in IMG/M
3300027662|Ga0208565_1198267Not Available572Open in IMG/M
3300027765|Ga0209073_10246306Not Available693Open in IMG/M
3300027767|Ga0209655_10054766All Organisms → cellular organisms → Bacteria → Proteobacteria1329Open in IMG/M
3300027889|Ga0209380_10047521All Organisms → cellular organisms → Bacteria2436Open in IMG/M
3300030013|Ga0302178_10476358Not Available547Open in IMG/M
3300030057|Ga0302176_10466808Not Available510Open in IMG/M
3300030509|Ga0302183_10254579Not Available681Open in IMG/M
3300030706|Ga0310039_10185765Not Available825Open in IMG/M
3300030739|Ga0302311_10931982Not Available554Open in IMG/M
3300031233|Ga0302307_10174814Not Available1111Open in IMG/M
3300031546|Ga0318538_10686662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300031546|Ga0318538_10834854Not Available501Open in IMG/M
3300031708|Ga0310686_104961563Not Available649Open in IMG/M
3300031713|Ga0318496_10168728All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300031769|Ga0318526_10212387Not Available791Open in IMG/M
3300031769|Ga0318526_10257106Not Available715Open in IMG/M
3300031781|Ga0318547_10826694Not Available577Open in IMG/M
3300031798|Ga0318523_10270480Not Available849Open in IMG/M
3300031799|Ga0318565_10114228All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium1300Open in IMG/M
3300031819|Ga0318568_10652189Not Available655Open in IMG/M
3300031832|Ga0318499_10157034Not Available887Open in IMG/M
3300031845|Ga0318511_10398229Not Available631Open in IMG/M
3300031860|Ga0318495_10033300All Organisms → cellular organisms → Bacteria2253Open in IMG/M
3300031910|Ga0306923_10003221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria15247Open in IMG/M
3300031910|Ga0306923_12532145Not Available505Open in IMG/M
3300031912|Ga0306921_11335839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium791Open in IMG/M
3300031947|Ga0310909_10126901All Organisms → cellular organisms → Bacteria → Terrabacteria group2079Open in IMG/M
3300031954|Ga0306926_10916651All Organisms → cellular organisms → Bacteria → Terrabacteria group1048Open in IMG/M
3300031954|Ga0306926_11003670Not Available993Open in IMG/M
3300032043|Ga0318556_10180230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1096Open in IMG/M
3300032064|Ga0318510_10103953Not Available1084Open in IMG/M
3300032066|Ga0318514_10337408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium798Open in IMG/M
3300032068|Ga0318553_10099167All Organisms → cellular organisms → Bacteria1484Open in IMG/M
3300032076|Ga0306924_10634970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus1205Open in IMG/M
3300032076|Ga0306924_11266684Not Available794Open in IMG/M
3300032089|Ga0318525_10489008Not Available630Open in IMG/M
3300032770|Ga0335085_11510575Not Available699Open in IMG/M
3300032770|Ga0335085_12300212Not Available539Open in IMG/M
3300032805|Ga0335078_10915196All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300032893|Ga0335069_10520024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1377Open in IMG/M
3300032896|Ga0335075_11615049All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300032954|Ga0335083_11367955Not Available542Open in IMG/M
3300033289|Ga0310914_10750524Not Available873Open in IMG/M
3300033290|Ga0318519_10827011Not Available570Open in IMG/M
3300034124|Ga0370483_0230730Not Available632Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil30.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.92%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.93%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.94%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.95%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.98%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.99%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.99%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.99%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.99%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.99%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.99%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.99%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.99%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.99%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.99%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.99%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022713Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025509Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ51221_1028300023300003505Forest SoilPVNRSDVMTVAVVARTDPQEQESVVTMNLPPHLAELDAFPVASQ*
Ga0070682_10199177023300005337Corn RhizosphereLPVNRSDVMTVAVVARTDPQEQESVVTMSLPPHLAELHDFPVATP*
Ga0070711_10140357213300005439Corn, Switchgrass And Miscanthus RhizospherePVNRSDVMTVAVVARTDPQEQESVVPMSLPPHLSDLESFPVAAQ*
Ga0070732_1001584943300005542Surface SoilNRSDVMTIAVVARTDPQEQESVVTLSLPPHLAELNAFPIASP*
Ga0066698_1074103213300005558SoilPVNRSDVVTVAVVARTDPQEQESVVIMSLPPHLADLDDFPVASP*
Ga0066699_1056992513300005561SoilNRSDVMTIAVVARTDPEEQESVITLTLPPHLADLSAFPVAGH*
Ga0070702_10019407913300005615Corn, Switchgrass And Miscanthus RhizosphereNRSDVMTVAVVARTDPQEQESVVTMTLPPHLAELHDFPVATP*
Ga0070766_1003339513300005921SoilHLPVNRSDVMTVAVVARTDPQEQESVITLSLPPHLSDLDAFPVASQ*
Ga0075432_1060122823300006058Populus RhizospherePVNRSNVTTVAVVARTDPQEQESVVTMSLPPHLAELDDFPVATP*
Ga0079220_1080044823300006806Agricultural SoilVNRSDVMTVAVVARTDPQEQESVVTMSLPPHLAELDDLPVASP*
Ga0075435_10072169213300007076Populus RhizosphereNRSDVMTVAVVARTDPQEQESVVTLSLPPHLAELDDFPVAAP*
Ga0116222_151970223300009521Peatlands SoilMTIAVVARTDPQEQESVVTLTLPPHLAGLSAFPVAAG*
Ga0116218_154798323300009522Peatlands SoilTTVAVVARTDPREQESVVTLTLPPHLAGLSAFPVAAG*
Ga0116221_152933213300009523Peatlands SoilMTVAVVARTDPQEQESVVTMSLPPHLAELDAFPVASQ*
Ga0126382_1203767913300010047Tropical Forest SoilSYDGKQGTDPQEQESVVTMSLPPHLAELDDLPVATP*
Ga0126373_1224970323300010048Tropical Forest SoilLPVNRSEVTTVAVVARTDPREQESVVTLSLPPHLSDLDAFPVASP*
Ga0127503_1024699923300010154SoilVNRSEVTTVAVVARTDPREQESVVTLSRPPHLSDLDAFPVAAG*
Ga0074045_1027270423300010341Bog Forest SoilAVVARTDPQEQESVVTMNLPPHLAELDAFPVASQ*
Ga0136449_10186494633300010379Peatlands SoilVAVVARTDPAERESVVTLSLPQHLSELDAFPVASPASPA*
Ga0126361_1018270423300010876Boreal Forest SoilAVVARTDPQEQESVVTMTLPPHLADLNDFPVASQ*
Ga0137376_1117751813300012208Vadose Zone SoilVNRSEVTTVAVVARTDPREQESVVTLSLPPHLADLDAFPVAAG*
Ga0157372_1171766023300013307Corn RhizosphereVNRSDVMTVAVVARTDPQEQESVVTMSLPPHLAELHDFPVATP*
Ga0182024_1285803113300014501PermafrostLPVNRSDVMTVAVVARTDPQEQESVVAMTLPPHLSDLNAFPVASQ*
Ga0137409_1086953523300015245Vadose Zone SoilVAVVARTDPQEQESVVPMSLPPHLAELDDFPVASP*
Ga0132255_10600075223300015374Arabidopsis RhizosphereTVAVVARTDPQEQESVVTMSLPPHLAELDGFPVATP*
Ga0182041_1193837213300016294SoilPVNRSDVMTVAVVARTDPQEQESVVTVSLPPHLYELNDFPIASQ
Ga0187812_123723823300017821Freshwater SedimentVNRSDVMTVAVVARTDPQEQESVVTLSLPPHLSDLNAFPVASQ
Ga0187807_111312523300017926Freshwater SedimentTVAVVARTDPQEQESVVTLSLPPHLSDLNAFPVASQ
Ga0187807_130874813300017926Freshwater SedimentNRSDVMTVAVVARTDPQEQESVVTLSLPPHLSDLNAFPIASQ
Ga0187814_1015346323300017932Freshwater SedimentDVMTVAVVARTDPQEQESVVTLSLPPHLSDLNAFPVASQ
Ga0187809_1005311713300017937Freshwater SedimentRSDVMTVAVVARTDPQEQESVVTLSLPPHLSELNAFPVASQ
Ga0187819_1052158113300017943Freshwater SedimentVNRSDVMTVAVVARTDPQEQESVVTMSLPPHLAELDAFPVASQ
Ga0187847_1035828323300017948PeatlandVMTVAVVARTDPQEQESVVTMNLPAHLAELNAFPVASQ
Ga0187765_1103984713300018060Tropical PeatlandHLPVNRSNVMTVAVVARTDPEEQESVVTMKMPPHLAELDAFPVASQ
Ga0187784_1040402923300018062Tropical PeatlandLPVNRSDVMTVAVVARTDPQEQESVVTLSLPPHLSELNAFPVASP
Ga0187784_1113338623300018062Tropical PeatlandVAVVARTDPQEQESVVTLSLPPHLSDLNAFPVASP
Ga0187770_1126699023300018090Tropical PeatlandPVNRSDVTTVAVVARTDPREQESVVTLSLPPHLASLEAFPVAAG
Ga0210399_1033834023300020581SoilRSDVMTVAVVARTDPQEQESVVTLSLPPHLSDLDAFPVASQ
Ga0210395_1014720223300020582SoilDVMTVAVVARTDPQEQESVVALSLPPHLSDLDAFPVASQ
Ga0210405_1007374923300021171SoilVNRSEVTTVAVVARTDPREQESVVTLSLPPHLADLDAFPVAAG
Ga0210408_1103906923300021178SoilVAVVARTDPQEQESVVTMSLPPHLAELDDYPVASP
Ga0210396_1152743713300021180SoilTIAVVARTDPQEQESVVTLSLPPHLADLSAFPVATE
Ga0213874_1022909613300021377Plant RootsHLPVNRSDVMTVAVVARTDPQEQESVVTMNLPPHLAELDAFPVASQ
Ga0210389_1003416633300021404SoilVMTVAVVARTDPQEQESVITLSLPPHLSDLDGFPVASQ
Ga0210387_1007349513300021405SoilVAVVARTDPQEQESVVTLSLPPHLSDLDAFPVASQ
Ga0210383_1178686413300021407SoilTVAVVARTDPQEQESVVTLSLPPHLSDLDAFPVASQ
Ga0210391_1144103923300021433SoilLPVNRSDVMTVAVVARTDPQEQESVVTLSLPPHLSDLDAFPVASQ
Ga0213878_1032290013300021444Bulk SoilTVAVVARTDPQEQESVVTLSLPPHLSELDAFPVASQ
Ga0210402_1172692513300021478SoilNRSDVMTVAVVARTDPQEQESVVTLSLPPHLAELDDFPVASP
Ga0242677_101007023300022713SoilVNRSDVMTVAVVARTDPQEQESVVTMNLPPHLAELAAFPVASR
Ga0208848_104793013300025509Arctic Peat SoilVAVVARTDPQEQESVVTLSLPPHLAELDDYPVASQ
Ga0207645_1023550413300025907Miscanthus RhizosphereTVAVVARTDPQEQESVVTLSLPPHLAELDDFPVASP
Ga0207663_1108590913300025916Corn, Switchgrass And Miscanthus RhizosphereVLTVAVVARTDPQEQESVVPVSLPAHLADLDAFPVASQ
Ga0207664_1101040723300025929Agricultural SoilPVNRSDVLTVAVVARTDAQEQESVVPLSLPPHLADLDEVPLASQ
Ga0207702_1195852223300026078Corn RhizosphereTVAVVARTDPQEQESVVTMSLPPHLAELHDFPVATP
Ga0208827_101746543300027641Peatlands SoilTIAVVARTDPQEQESVVTLSLPPHLSDLNAFPVASQ
Ga0208565_119826723300027662Peatlands SoilPVNRSDVMTVAVVARTDPQEQESVVTMTLPPHLAELDAFPVASQ
Ga0209073_1024630613300027765Agricultural SoilTVAVVARTDPQEQESVVTMSLPPHLAELDDLPVASP
Ga0209655_1005476613300027767Bog Forest SoilSDVMTVAVVARTDPQEQESVVTLSLPPHLSDLDAFPVASQ
Ga0209380_1004752143300027889SoilLPVNRSDVMTVAVVARTDPQEQESVITLSLPPHLSDLDAFPVASQ
Ga0302178_1047635823300030013PalsaMTVAVVARTDPQEQESVVPMSLPPHLSDLDAFPVAAQ
Ga0302176_1046680813300030057PalsaRSDVTTVAVVARTDPQEQESVVTISLPPHLSDLDAFPVASQ
Ga0302183_1025457923300030509PalsaNRSDVTTVAVVARTDPQEQESVVTMNLPPHLADLNAFPVASR
Ga0310039_1018576513300030706Peatlands SoilPVNRSDVMTVAIVARTDPQEQESVVTLSLPPHLSDLNAFPVASQ
Ga0302311_1093198213300030739PalsaDVMTVAVVARTDPQEQESVVTMNLPPHLAELNAFPVASQ
Ga0302307_1017481423300031233PalsaTTVAVVARTDPQEQESVVTMNLPPHLAELNAFPVASQ
Ga0318538_1068666223300031546SoilTTTVAVVARTDPREQESVVTLSLPPHLAGLDAFPVAAG
Ga0318538_1083485423300031546SoilVMTVAVVARTDPQEQESVVTMSLPPHLAELDDFPVATP
Ga0310686_10496156313300031708SoilNRSDVMTVAVVARTDPQEQESVVTMKLPPHLAELDAFPIASG
Ga0318496_1016872813300031713SoilAVVARTDPHEQESVATLSLPPHLAELNAFPVASPGTPT
Ga0318526_1021238713300031769SoilNRSDVTTVAVVARTDPQEQESVVTLSLPPHLADLDAFPVASQ
Ga0318526_1025710613300031769SoilMTVAVVARTDPQEQESVVTMSLPPHLAELDDFPVATP
Ga0318547_1082669413300031781SoilVMAVAVVAGTDPHEQESVVTLSLPPHLAELNAFPVASPGTPT
Ga0318523_1027048013300031798SoilTVAVVARTDPQEQESVVTVSLPPHLYELNDFPIASQ
Ga0318565_1011422813300031799SoilDVVTVAVVARTDPQEQESVVTMSLPPHLAELDDFPVATP
Ga0318568_1065218913300031819SoilLTAVAVVARTDPHEQESVATLSLPPHLAELNAFPVASPGTPT
Ga0318499_1015703413300031832SoilNRSDVMAVAVVAGTDPHEQESVVTLSLPPHLAELNAFPVASPGTPT
Ga0318511_1039822923300031845SoilRSDVMTVAVVARTDPQEQESVVTMSLPPHLADLDDFPVASP
Ga0318495_1003330023300031860SoilTVAVVARTDPQEQESVVTMSLPPHLADLDDFPVASP
Ga0306923_1000322113300031910SoilTTVAVVARTDPREQESVVTLSLPAHLAGLDAFPVAAG
Ga0306923_1253214513300031910SoilVAVVARTDPREQESVVTLSLPPHLADLEAFPVAAG
Ga0306921_1133583933300031912SoilSDVTTVAVVARTDPREQESVVTLRLPPHLADLDAFPVAAG
Ga0310909_1012690113300031947SoilVTTVAVVARTDPREQESVVTLSLPPHLADLDAFPVAAG
Ga0306926_1091665113300031954SoilLPVNRSDVTAAAVVDSTDPHEQESVVTLSLPPHLAELNAFPIASPGTPT
Ga0306926_1100367023300031954SoilLPVNRSDVMTVAVVARTDPQEQESVVTLSLPPHLADLDAFPVASQ
Ga0318556_1018023023300032043SoilSDVMAVAVVARTDPHEQESVVTLSLPPHLAELNAFPVASPGTPT
Ga0318510_1010395323300032064SoilRSDVMTVAVVARTDPQEQESVVTVSLPPHLYELNDFPIASQ
Ga0318514_1033740823300032066SoilTVAVVARTDPREQESVVTLSLPAHLAGLDAFPVAAG
Ga0318553_1009916723300032068SoilARTDPHEQESVATLSLPPHLAELNAFPVASPGTPT
Ga0306924_1063497023300032076SoilVARTDPHEQESVVTLSLPPHLAELNAFPVASPGTPT
Ga0306924_1126668413300032076SoilNRGDLTAVAVVARTDPHEQESVATLSLPPHLAELNAFPVASPGTPT
Ga0318525_1048900823300032089SoilVNRSDVMAVAVVAGTDPHEQESVVTLSLPPHLAELNAFPVASPGTPT
Ga0335085_1151057523300032770SoilHLPVNRSDVMTVAVVARTDPQEQESVVTVSLPPHLAELDDFPVAAQ
Ga0335085_1230021213300032770SoilHLPVNRSDVMTVAVVARTDPQEQESVVTMSLPPHLAELDDFPVATP
Ga0335078_1091519613300032805SoilPVNRSDVMTVAVVARTDPQEQESVVTMSLPPHLAELDDFPVASP
Ga0335069_1052002433300032893SoilGIPHLPVNRSDVLTVAVVARTDAQEQESVVPLSLPPHLADLDEVPLASQ
Ga0335075_1161504923300032896SoilLPVNRSDVMTVAVVARTDPQEQESVVTISLPPHLAELNAFPIASPDTPA
Ga0335083_1136795523300032954SoilPVNRSDVMTVAVVARTDPQEQESVVTMKLPPHLAELDAFPVASH
Ga0310914_1075052413300033289SoilNRSDVMTIAVVARTDPQEQESVVTLSLPPHLADLDAFPVASP
Ga0318519_1082701113300033290SoilVARTDPHEQESVATLSLPPHLAELNAFPVASPGTPT
Ga0370483_0230730_506_6193300034124Untreated Peat SoilMTVAVVARTDPQEQESVVTMSLPPHLAELNAFPVASQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.